Comparing RR42_RS32050 FitnessBrowser__Cup4G11:RR42_RS32050 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2xuaH Crystal structure of the enol-lactonase from burkholderia xenovorans lb400 (see paper)
48% identity, 65% coverage: 1:257/397 of query aligns to 1:259/261 of 2xuaH
6eb3B Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 63% coverage: 8:257/397 of query aligns to 8:263/268 of 6eb3B
6eb3A Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 63% coverage: 8:257/397 of query aligns to 8:260/265 of 6eb3A
6eb3C Structural and enzymatic characterization of an esterase from a metagenomic library
31% identity, 63% coverage: 8:257/397 of query aligns to 8:257/262 of 6eb3C
4uhfA Structural studies of a thermophilic esterase from thermogutta terrifontis (l37a mutant with butyrate bound) (see paper)
28% identity, 59% coverage: 22:257/397 of query aligns to 27:267/278 of 4uhfA
4uheA Structural studies of a thermophilic esterase from thermogutta terrifontis (malate bound) (see paper)
28% identity, 59% coverage: 22:257/397 of query aligns to 27:267/272 of 4uheA
4uhdA Structural studies of a thermophilic esterase from thermogutta terrifontis (acetate bound) (see paper)
28% identity, 59% coverage: 22:257/397 of query aligns to 27:267/274 of 4uhdA
5z7xA Crystal structure of striga hermonthica htl4 (shhtl4) (see paper)
23% identity, 56% coverage: 24:244/397 of query aligns to 21:255/270 of 5z7xA
5h3hB Esterase (eaest) from exiguobacterium antarcticum (see paper)
23% identity, 64% coverage: 3:257/397 of query aligns to 4:266/269 of 5h3hB
O07015 Sigma factor SigB regulation protein RsbQ from Bacillus subtilis (strain 168) (see paper)
22% identity, 59% coverage: 24:257/397 of query aligns to 21:265/269 of O07015
5cbkA Crystal structure of the strigolactone receptor shhtl5 from striga hermonthica (see paper)
22% identity, 53% coverage: 24:233/397 of query aligns to 20:247/271 of 5cbkA
Sites not aligning to the query:
Q9SQR3 Strigolactone esterase D14; Protein DWARF 14; AtD14; EC 3.1.-.- from Arabidopsis thaliana (Mouse-ear cress) (see 4 papers)
22% identity, 58% coverage: 23:253/397 of query aligns to 21:261/267 of Q9SQR3
8dvcA Receptor shhtl5 from striga hermonthica in complex with strigolactone agonist gr24 (see paper)
22% identity, 53% coverage: 24:233/397 of query aligns to 18:245/268 of 8dvcA
A0A109QYD3 Strigolactone esterase RMS3; Protein DWARF 14 homolog; PsD14; Protein RAMOSUS 3; EC 3.1.-.- from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see paper)
20% identity, 58% coverage: 24:253/397 of query aligns to 21:261/267 of A0A109QYD3
Sites not aligning to the query:
6o5jA Crystal structure of dad2 bound to quinazolinone derivative (see paper)
21% identity, 58% coverage: 23:253/397 of query aligns to 18:258/264 of 6o5jA
6ap7A Crystal structure of dad2 in complex with 2-(2-methyl-3-nitroanilino) benzoic acid (see paper)
21% identity, 58% coverage: 23:253/397 of query aligns to 18:258/264 of 6ap7A
6ap6A Crystal structure of dad2 in complex with tolfenamic acid (see paper)
21% identity, 58% coverage: 23:253/397 of query aligns to 18:258/264 of 6ap6A
J9U5U9 Probable strigolactone esterase DAD2; Protein DECREASED APICAL DOMINANCE 2; EC 3.1.-.- from Petunia hybrida (Petunia) (see paper)
21% identity, 58% coverage: 23:253/397 of query aligns to 20:260/267 of J9U5U9
5z7wB Crystal structure of striga hermonthica htl1 (shhtl1) (see paper)
22% identity, 58% coverage: 24:254/397 of query aligns to 22:263/271 of 5z7wB
P25026 Non-heme chloroperoxidase; Chloride peroxidase; Chloroperoxidase P; CPO-P; EC 1.11.1.- from Burkholderia pyrrocinia (Pseudomonas pyrrocinia) (see paper)
27% identity, 53% coverage: 1:212/397 of query aligns to 1:229/278 of P25026
Sites not aligning to the query:
>RR42_RS32050 FitnessBrowser__Cup4G11:RR42_RS32050
MPFITHAGNRLFYTLEGPASAPVLIFSNSLGTDHTMWAPQVEALGQQFRILRYDTRGHGR
SALPPGPSSVAELGSDVIALMDALQIQKAAFCGLSMGGLTGMWLGVNAPQRFTRIVLANT
APRIGTHEAWNTRIEGVLRDGMTPLVEGSLQRWFTPAFVSAAGNQLDDLRQVLTGLDARG
YAANCAAVRDADLREAVKTIPVPVLVIAGSADPSTTAEQGRALADAIPGARYLELEAAHL
SNREQPARFTEALLDFLGGDAQQAAGRPANDGERYQAGLAVRRAVLGSAHVDRSLAKLNP
LTEEFQNLITRYAWGEIWTREGLPRHSRSLITIAMMVALNRGEELKLHLRAAANNKVSRD
EVKEVLLQTAIYCGVPAANSAFHMAEEVFAEEDLKGV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory