Comparing RR42_RS32440 FitnessBrowser__Cup4G11:RR42_RS32440 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
43% identity, 99% coverage: 1:343/346 of query aligns to 8:337/352 of 1cjxA
7x8eA Crystal structure of pfhppd-y13287 complex
43% identity, 99% coverage: 1:343/346 of query aligns to 10:329/341 of 7x8eA
7xntA Crystal structure of pfhppd-y13161 complex
43% identity, 99% coverage: 1:343/346 of query aligns to 11:333/341 of 7xntA
7xntC Crystal structure of pfhppd-y13161 complex
43% identity, 99% coverage: 1:343/346 of query aligns to 10:317/320 of 7xntC
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
34% identity, 100% coverage: 2:346/346 of query aligns to 297:618/624 of 5hmqD
Sites not aligning to the query:
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
34% identity, 100% coverage: 2:346/346 of query aligns to 295:621/635 of Q88JU3
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
30% identity, 84% coverage: 55:343/346 of query aligns to 73:352/362 of 1t47A
7yvvA Acmp1, r-4-hydroxymandelate synthase
30% identity, 87% coverage: 47:346/346 of query aligns to 57:329/335 of 7yvvA
2r5vA Hydroxymandelate synthase crystal structure (see paper)
28% identity, 90% coverage: 33:343/346 of query aligns to 39:336/346 of 2r5vA
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
28% identity, 90% coverage: 33:343/346 of query aligns to 40:338/357 of O52791
8i0yA Crystal structure of athppd-y191713 complex
28% identity, 78% coverage: 59:329/346 of query aligns to 97:351/382 of 8i0yA
Sites not aligning to the query:
7x6nA Crystal structure of athppd-y191710 complex
28% identity, 78% coverage: 59:329/346 of query aligns to 97:351/382 of 7x6nA
Sites not aligning to the query:
1sp8D 4-hydroxyphenylpyruvate dioxygenase (see paper)
30% identity, 77% coverage: 62:329/346 of query aligns to 97:352/393 of 1sp8D
7x5wA Crystal structure of athppd-y18022 complex
28% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 7x5wA
Sites not aligning to the query:
7x5rA Crystal structure of athppd-lancotrione complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/386 of 7x5rA
Sites not aligning to the query:
8i15A Crystal structure of athppd-yh20335 complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 8i15A
Sites not aligning to the query:
8i0gA Crystal structure of athppd-y19543 complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 8i0gA
Sites not aligning to the query:
8hysA Crystal structure of athppd-y19802 complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 8hysA
Sites not aligning to the query:
8hypA Crystal structure of athppd-y18400 complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 8hypA
Sites not aligning to the query:
8hymA Crystal structure of athppd-y18030 complex
27% identity, 83% coverage: 42:329/346 of query aligns to 76:350/381 of 8hymA
Sites not aligning to the query:
>RR42_RS32440 FitnessBrowser__Cup4G11:RR42_RS32440
MGYEFVEFASPDPAALGRTFERFGFHAIAQHRHKNVKLFRQGEMNFIVDAEPDSFATRYA
SEYGLSICAVGIRVNDAATAFARAVDAGAWPFEAGTVGPMELNIPAIQGIGRSIIYFIDR
WRGKEGRPGDVGDISIYDVDFRALAHAATDTAATTAGAGLARVDHVTQAVDPGHLEEWLD
FYRKVLGFREIHEVNAGWHVASDSRVLLSPCGLIRIPIYEKGTQRHDQMEHYLSGHHGEG
IQHIALATDDLVASAAALARNGVRFVEPPAAYYDTVDARVPGHGLDLAALRRYGILVDGA
LRADGTREAFLQAFARREAGEFFFEIVQRDNYHGFGEGNLPALEAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory