Comparing RR42_RS32485 FitnessBrowser__Cup4G11:RR42_RS32485 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q88JU3 3-dehydroshikimate dehydratase; DSD; EC 4.2.1.118 from Pseudomonas putida (strain ATCC 47054 / DSM 6125 / CFBP 8728 / NCIMB 11950 / KT2440) (see paper)
53% identity, 98% coverage: 10:626/627 of query aligns to 3:633/635 of Q88JU3
5hmqD Xylose isomerase-like tim barrel/4-hydroxyphenylpyruvate dioxygenase fusion protein
54% identity, 97% coverage: 10:618/627 of query aligns to 5:622/624 of 5hmqD
1cjxA Crystal structure of pseudomonas fluorescens hppd (see paper)
36% identity, 51% coverage: 288:607/627 of query aligns to 9:333/352 of 1cjxA
Sites not aligning to the query:
7xntA Crystal structure of pfhppd-y13161 complex
35% identity, 51% coverage: 288:607/627 of query aligns to 12:329/341 of 7xntA
Sites not aligning to the query:
7xntC Crystal structure of pfhppd-y13161 complex
34% identity, 51% coverage: 288:607/627 of query aligns to 11:313/320 of 7xntC
Sites not aligning to the query:
7x8eA Crystal structure of pfhppd-y13287 complex
35% identity, 51% coverage: 288:607/627 of query aligns to 11:325/341 of 7x8eA
Sites not aligning to the query:
1t47A Structure of fe2-hppd bound to ntbc (see paper)
29% identity, 42% coverage: 345:607/627 of query aligns to 75:348/362 of 1t47A
Sites not aligning to the query:
2r5vA Hydroxymandelate synthase crystal structure (see paper)
28% identity, 51% coverage: 289:607/627 of query aligns to 5:332/346 of 2r5vA
Sites not aligning to the query:
O52791 4-hydroxymandelate synthase; HMS; HmaS; 4-hydroxyphenylpyruvate dioxygenase II; EC 1.13.11.46 from Amycolatopsis orientalis (Nocardia orientalis) (see paper)
27% identity, 51% coverage: 289:607/627 of query aligns to 6:334/357 of O52791
8im2A Crystal structure of human hppd complexed with ntbc (see paper)
23% identity, 46% coverage: 320:607/627 of query aligns to 49:357/374 of 8im2A
Sites not aligning to the query:
8im3A Crystal structure of human hppd complexed with compound a10 (see paper)
23% identity, 46% coverage: 320:607/627 of query aligns to 49:357/371 of 8im3A
Sites not aligning to the query:
5ec3A Structural insight into the catalyitc mechanism of human 4- hydroxyphenylpyruvate dioxygenase
23% identity, 46% coverage: 320:607/627 of query aligns to 47:355/376 of 5ec3A
P32755 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; F Alloantigen; F protein; EC 1.13.11.27 from Rattus norvegicus (Rat) (see 2 papers)
24% identity, 46% coverage: 320:607/627 of query aligns to 55:363/393 of P32755
Sites not aligning to the query:
Q02110 4-hydroxyphenylpyruvate dioxygenase; 4-hydroxyphenylpyruvic acid oxidase; 4HPPD; HPD; HPPDase; EC 1.13.11.27 from Sus scrofa (Pig) (see paper)
27% identity, 28% coverage: 431:607/627 of query aligns to 176:363/393 of Q02110
Sites not aligning to the query:
1sqiA Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
24% identity, 46% coverage: 320:607/627 of query aligns to 48:340/343 of 1sqiA
Sites not aligning to the query:
1sqiB Structural basis for inhibitor selectivity revealed by crystal structures of plant and mammalian 4-hydroxyphenylpyruvate dioxygenases (see paper)
24% identity, 46% coverage: 320:607/627 of query aligns to 49:339/342 of 1sqiB
Sites not aligning to the query:
7yvvA Acmp1, r-4-hydroxymandelate synthase
25% identity, 43% coverage: 341:609/627 of query aligns to 60:324/335 of 7yvvA
3zgjB S221m v223f y359a mutant of 4-hydroxymandelate synthase from streptomyces coelicolor (see paper)
25% identity, 48% coverage: 305:607/627 of query aligns to 21:330/343 of 3zgjB
1i6nA 1.8 a crystal structure of ioli protein with a binding zinc atom (see paper)
28% identity, 27% coverage: 98:267/627 of query aligns to 96:263/278 of 1i6nA
1sp8D 4-hydroxyphenylpyruvate dioxygenase (see paper)
28% identity, 40% coverage: 351:601/627 of query aligns to 98:356/393 of 1sp8D
>RR42_RS32485 FitnessBrowser__Cup4G11:RR42_RS32485
MDTTIWRHPKSIATVSLSGTLPEKLEAAAAAGFDGVEIFENDLLNFDGSPADVRRIAADL
GLAIMLYQPFRDFEAMPDAIRERNMARAERKFDVMEELGARMVLVCSNVQEIAIDDPARA
AADLRAMAEAAAKRGLSVAYEALAWGRHTRRWRQAWEIVRQADHPALGLVLDSFHTLALG
DTLEGIGEVPAEKIFFMQLADAPRMSMDVLSWSRHYRNFPGQGDLAVTEFARAAMGAGYR
GPLSLEIFNDEFRAAPARLTALDGLRSLIWLESEAGGPPLPAPPRFGGVDFLEFAVDYVT
GRELGARLRSLGFGHAGRHRSKAVELYRQGGVNIILNAEQDSAAAEHFQLHGPSVCALGL
KVDDAQRAVTRARALLCKEWRERIGPHERSIPALRAPDGMLFYLIDEQGSDRSIYESDFV
LEPGGADSAGAGLMAIDHIAQALPPHRLDSFVLFYKTVFGLQAQALHEIADPYGLVKSRA
MVSAEQSLRIPLNVSESSRTATGRFITAYAGSGIHHIAFRTPDLCATLDQAVPAEAAMLH
VPDNYYDDVGARLGLDDAALEHLRQHQLLYDRDAGGEFLHAYTEPFHDRFFFELVQRDGY
LGFGAANASLRMAAQALASRNRQARPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory