Comparing RR42_RS32655 FitnessBrowser__Cup4G11:RR42_RS32655 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1mpyA Structure of catechol 2,3-dioxygenase (metapyrocatechase) from pseudomonas putida mt-2 (see paper)
58% identity, 99% coverage: 5:310/310 of query aligns to 4:307/307 of 1mpyA
3hpvA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. Kl28 (see paper)
50% identity, 96% coverage: 2:299/310 of query aligns to 1:297/297 of 3hpvA
3hq0B Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in complex with a product (see paper)
51% identity, 92% coverage: 2:286/310 of query aligns to 1:284/288 of 3hq0B
3hpyA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol (see paper)
51% identity, 92% coverage: 2:286/310 of query aligns to 1:284/288 of 3hpyA
5zsxA Catechol 2,3-dioxygenase with 3-fluorocatechol from diaphorobacter sp ds2
44% identity, 99% coverage: 5:310/310 of query aligns to 2:314/314 of 5zsxA
5znhA Catechol 2,3-dioxygenase with 4-methyl catechol from diaphorobacter sp ds2
44% identity, 99% coverage: 5:310/310 of query aligns to 2:314/314 of 5znhA
3lm4A Crystal structure of 2,3-dihydroxy biphenyl dioxygenase from rhodococcus sp. (Strain rha1)
29% identity, 89% coverage: 20:294/310 of query aligns to 20:296/325 of 3lm4A
Sites not aligning to the query:
7q2aB Crystal structure of aphc in complex with 4-ethylcatechol (see paper)
29% identity, 89% coverage: 20:294/310 of query aligns to 20:296/352 of 7q2aB
Sites not aligning to the query:
1f1vA Anaerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis. (Complex with 3,4- dihydroxyphenylacetate) (see paper)
25% identity, 90% coverage: 6:285/310 of query aligns to 12:282/320 of 1f1vA
Sites not aligning to the query:
1f1uA Crystal structure of homoprotocatechuate 2,3-dioxygenase from arthrobacter globiformis (native, low temperature) (see paper)
25% identity, 90% coverage: 6:285/310 of query aligns to 14:284/322 of 1f1uA
1q0cA Anerobic substrate complex of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum. (Complex with 3,4-dihydroxyphenylacetate) (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/319 of 1q0cA
Sites not aligning to the query:
1f1xA Crystal structure of homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/319 of 1f1xA
3eckC Structure of e323l homoprotocatechuate 2,3-dioxygenase from brevibacterium fuscum in complex with putative o-o bond cleavage intermediate formed via in crystallo reaction with 4-sulfonyl catechol at low oxygen concentrations (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 3eckC
Sites not aligning to the query:
3bzaA Structure of mn-substituted homoprotocatechuate 2,3-dioxygenase from b.Fuscum at 1.7 ang resolution (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 3bzaA
2igaC Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 2igaC
Sites not aligning to the query:
2igaB Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 2igaB
Sites not aligning to the query:
2igaA Structure of homoprotocatechuate 2,3-dioxygenase from b. Fuscum in complex with reactive intermediates formed via in crystallo reaction with 4-nitrocatechol at low oxygen concentrations. (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 2igaA
Sites not aligning to the query:
2ig9B Structure of a full-length homoprotocatechuate 2,3-dioxygenase from b. Fuscum in a new spacegroup. (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/359 of 2ig9B
3ojkA Structure of co-substituted homoprotocatechuate 2,3-dioxygenase in complex with 4-nitrocatechol at 1.68 ang resolution (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/355 of 3ojkA
Sites not aligning to the query:
3ojjA Structure of co-substituted homoprotocatechuate 2,3-dioxygenase from b.Fuscum at 1.72 ang resolution (see paper)
25% identity, 92% coverage: 6:289/310 of query aligns to 12:288/355 of 3ojjA
>RR42_RS32655 FitnessBrowser__Cup4G11:RR42_RS32655
MALTGVLRPGHVALRVLELEPALKHYTEVLGLIETARDDKGRVYLKAWDEHDHHSVVLRE
ADSPGMDYMGFRVDSGRTLEWLAQEVEQSGLASDFQWIPAGEHPRTGVRFRFTIPTGHAI
ELFADKDKLGCLTGDSNPDPWPDDLRGMAPSRFDHCLLYGDDLDGTVRLFRDVLGFTLAE
EVVAGPGKMMIGAFLTCSNKAHDIAFIRHAEKNKFHHASFNLDNWGEVLKAADIISKKDV
SLDIGPTRHGITRGATIYFFDPSGNRNEVFSGGYIHYPDKPTITWTDNELGKAIFYHDRK
LNDAFLNVLT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory