SitesBLAST
Comparing RR42_RS32665 FitnessBrowser__Cup4G11:RR42_RS32665 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
38% identity, 94% coverage: 10:341/355 of query aligns to 9:333/334 of P0DPQ8
Sites not aligning to the query:
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
38% identity, 94% coverage: 10:341/355 of query aligns to 8:332/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (= Y138), R144 (= R150), Q145 (≠ A151), Y146 (≠ F152), S147 (= S153), H161 (= H166), V162 (= V167), V165 (= V170), G168 (= G173), V169 (≠ Q174), A170 (= A175), T171 (= T176), T214 (≠ S215), F329 (= F338), P331 (≠ S340)
- binding fe2/s2 (inorganic) cluster: C34 (= C36), N35 (≠ C37), G37 (= G39), C39 (= C41), G40 (≠ A42), C42 (= C44), C74 (= C76)
Sites not aligning to the query:
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
28% identity, 87% coverage: 9:318/355 of query aligns to 13:314/337 of 1krhA
- active site: C306 (= C310)
- binding flavin-adenine dinucleotide: Y143 (= Y138), R155 (= R150), S156 (≠ A151), Y157 (≠ F152), S158 (= S153), V171 (≠ H166), V172 (= V167), G178 (= G173), K179 (≠ Q174), M180 (≠ A175), S181 (≠ T176), T219 (≠ S215)
- binding fe2/s2 (inorganic) cluster: M38 (≠ H34), D39 (≠ A35), C40 (= C36), R41 (≠ C37), G43 (= G39), C45 (= C41), G46 (≠ A42), C48 (= C44), C82 (= C76)
Sites not aligning to the query:
4wqmA Structure of the toluene 4-monooxygenase nadh oxidoreductase t4mof, k270s k271s variant (see paper)
29% identity, 91% coverage: 17:339/355 of query aligns to 17:326/326 of 4wqmA
- binding flavin-adenine dinucleotide: C36 (= C36), S38 (≠ H38), W57 (≠ E57), Y135 (= Y138), R146 (= R150), A147 (= A151), Y148 (≠ F152), S149 (= S153), I162 (≠ H166), V163 (= V167), G169 (= G173), K170 (≠ Q174), V171 (≠ A175), S172 (≠ T176), S209 (= S215), F325 (= F338)
- binding fe2/s2 (inorganic) cluster: Y34 (≠ H34), C36 (= C36), N37 (≠ C37), G39 (= G39), C41 (= C41), G42 (≠ A42), C44 (= C44), C76 (= C76)
Q03304 Toluene-4-monooxygenase system, ferredoxin--NAD(+) reductase component; T4MO; Ferredoxin--NAD(+) reductase; Toluene-4-monooxygenase systme, electron transfer component; EC 1.18.1.3 from Pseudomonas mendocina (see paper)
29% identity, 91% coverage: 17:339/355 of query aligns to 17:326/326 of Q03304
7c3bC Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
29% identity, 95% coverage: 2:339/355 of query aligns to 7:334/334 of 7c3bC
7qu0A X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
29% identity, 67% coverage: 100:338/355 of query aligns to 2:279/279 of 7qu0A
- binding ~{N}-[2,6-bis(fluoranyl)phenyl]ethanamide: S213 (= S271), F227 (≠ Y285), M256 (= M315)
- binding flavin-adenine dinucleotide: Y40 (= Y138), R83 (= R150), A84 (= A151), Y85 (≠ F152), S86 (= S153), A104 (vs. gap), T105 (vs. gap), P106 (vs. gap), P107 (vs. gap), A113 (≠ V170), P114 (≠ E171), P115 (≠ G172), G116 (= G173), I117 (≠ Q174), M118 (≠ A175), S119 (≠ T176), F279 (= F338)
7qtyA X-ray structure of fad domain of nqrf of klebsiella pneumoniae (see paper)
29% identity, 67% coverage: 100:338/355 of query aligns to 2:279/279 of 7qtyA
- binding 1-(furan-2-ylmethyl)-3-(2-methylphenyl)thiourea: A184 (= A242), R185 (= R243), S213 (= S271), F227 (≠ Y285), H229 (= H287), V255 (≠ P314), M256 (= M315)
- binding flavin-adenine dinucleotide: Y40 (= Y138), R83 (= R150), A84 (= A151), Y85 (≠ F152), S86 (= S153), N100 (≠ H166), A104 (vs. gap), T105 (vs. gap), P107 (vs. gap), A113 (≠ V170), P114 (≠ E171), G116 (= G173), I117 (≠ Q174), M118 (≠ A175), S119 (≠ T176), F279 (= F338)
8a1uF Sodium pumping nadh-quinone oxidoreductase with substrates nadh and q2 (see paper)
28% identity, 77% coverage: 67:338/355 of query aligns to 101:405/405 of 8a1uF
- binding flavin-adenine dinucleotide: Y166 (= Y138), R209 (= R150), A210 (= A151), Y211 (≠ F152), S212 (= S153), A230 (vs. gap), P233 (vs. gap), V239 (= V170), P240 (≠ E171), G242 (= G173), Q243 (= Q174), M244 (≠ A175), A282 (≠ S215), F405 (= F338)
- binding fe2/s2 (inorganic) cluster: C110 (= C76)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S212 (= S153), R228 (= R168), G281 (= G214), A282 (≠ S215), G309 (= G241), R311 (= R243), S339 (= S271), F353 (≠ Y285), C377 (= C310), G378 (= G311), P379 (= P312), M381 (≠ P314), M382 (= M315), D403 (≠ E336)
Sites not aligning to the query:
8a1yF Sodium pumping nadh-quinone oxidoreductase with inhibitor hqno (see paper)
28% identity, 77% coverage: 67:338/355 of query aligns to 102:406/408 of 8a1yF
- binding flavin-adenine dinucleotide: R210 (= R150), A211 (= A151), Y212 (≠ F152), S213 (= S153), V228 (= V167), R229 (= R168), A231 (vs. gap), V240 (= V170), P241 (≠ E171), G243 (= G173), Q244 (= Q174), M245 (≠ A175)
- binding fe2/s2 (inorganic) cluster: C111 (= C76)
Sites not aligning to the query:
A5F5Y4 Na(+)-translocating NADH-quinone reductase subunit F; Na(+)-NQR subunit F; Na(+)-translocating NQR subunit F; NQR complex subunit F; NQR-1 subunit F; EC 7.2.1.1 from Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) (see paper)
28% identity, 77% coverage: 67:338/355 of query aligns to 102:406/408 of A5F5Y4
- C111 (= C76) binding ; mutation to A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- R210 (= R150) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- Y212 (≠ F152) mutation to L: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
- S246 (≠ T176) mutation to A: Decreases flavin content, but does not affect the 2Fe-2S center. Exhibits very low NADH:quinone oxidoreductase activity.
Sites not aligning to the query:
- 70 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 76 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
- 79 binding ; C→A: Loss of the 2Fe-2S center, but does not affect flavin content. Exhibits very low NADH:quinone oxidoreductase activity.
7c3aA Ferredoxin reductase in carbazole 1,9a-dioxygenase (see paper)
29% identity, 95% coverage: 2:339/355 of query aligns to 6:321/321 of 7c3aA
- binding flavin-adenine dinucleotide: C39 (= C36), S41 (≠ H38), W60 (≠ E57), R152 (= R150), A153 (= A151), Y154 (≠ F152), S155 (= S153), Y169 (≠ H166), I170 (≠ V167), G176 (= G173), R177 (≠ Q174), F178 (≠ A175), S179 (≠ T176), A218 (≠ S215), F320 (= F338), F321 (≠ I339)
- binding fe2/s2 (inorganic) cluster: Y37 (≠ H34), C39 (= C36), A40 (≠ C37), G42 (= G39), C44 (= C41), G45 (≠ A42), C47 (= C44), C80 (= C76)
4u9uA Crystal structure of nqrf fad-binding domain from vibrio cholerae (see paper)
28% identity, 67% coverage: 101:338/355 of query aligns to 1:277/279 of 4u9uA
- binding flavin-adenine dinucleotide: Y38 (= Y138), R81 (= R150), A82 (= A151), Y83 (≠ F152), S84 (= S153), N98 (≠ H166), A102 (vs. gap), T103 (vs. gap), P104 (vs. gap), V111 (= V170), P112 (≠ E171), G114 (= G173), Q115 (= Q174), M116 (≠ A175), S117 (≠ T176), F277 (= F338)
- binding magnesium ion: K14 (≠ L114), Y59 (vs. gap), R186 (≠ T246), M188 (≠ L248)
- binding sodium ion: A198 (= A258), N201 (≠ H261), D202 (≠ P262), F204 (= F264)
2r6hC Crystal structure of the domain comprising the NAD binding and the fad binding regions of the nadh:ubiquinone oxidoreductase, na translocating, f subunit from porphyromonas gingivalis
25% identity, 62% coverage: 101:319/355 of query aligns to 6:269/289 of 2r6hC
- active site: C260 (= C310)
- binding flavin-adenine dinucleotide: Y43 (= Y138), R86 (= R150), A87 (= A151), Y88 (≠ F152), S89 (= S153), N103 (≠ H166), A107 (vs. gap), T108 (vs. gap), I122 (≠ V170), K123 (≠ E171), P124 (≠ G172), G125 (= G173), I126 (≠ Q174), S127 (≠ A175), S128 (≠ T176)
Sites not aligning to the query:
7qu3A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 67% coverage: 100:338/355 of query aligns to 2:278/279 of 7qu3A
- binding flavin-adenine dinucleotide: Y40 (= Y138), R83 (= R150), A84 (= A151), Y85 (≠ F152), S86 (= S153), N100 (≠ H166), A104 (vs. gap), S105 (vs. gap), L112 (≠ V170), P113 (≠ E171), G115 (= G173), Q116 (= Q174), M117 (≠ A175), S118 (≠ T176), A155 (≠ S215), F278 (= F338)
- binding 4-(benzimidazol-1-ylmethyl)benzenecarbonitrile: R102 (= R168), G154 (= G214), G182 (= G241), F226 (≠ Y285), I227 (≠ V286), P252 (= P312), M255 (= M315)
7qu5A X-ray structure of fad domain of nqrf of pseudomonas aeruginosa (see paper)
27% identity, 67% coverage: 100:338/355 of query aligns to 2:278/280 of 7qu5A
- binding flavin-adenine dinucleotide: Y40 (= Y138), R83 (= R150), A84 (= A151), Y85 (≠ F152), S86 (= S153), N100 (≠ H166), A104 (vs. gap), L112 (≠ V170), P113 (≠ E171), G115 (= G173), Q116 (= Q174), M117 (≠ A175), S118 (≠ T176), A155 (≠ S215), F278 (= F338)
- binding gamma-Valerolactone: F19 (≠ T117), F68 (vs. gap), M70 (vs. gap), S105 (vs. gap), P108 (vs. gap), D196 (≠ R255), W207 (≠ Y266), H208 (≠ V267), L209 (≠ P268)
7c3bB Ferredoxin reductase in carbazole 1,9a-dioxygenase (fad apo form) (see paper)
27% identity, 95% coverage: 2:339/355 of query aligns to 6:306/306 of 7c3bB
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
27% identity, 69% coverage: 101:344/355 of query aligns to 8:250/250 of 1tvcA
- active site: Y63 (≠ F152), S64 (= S153), L215 (= L309)
- binding dihydroflavine-adenine dinucleotide: N24 (≠ T117), F49 (≠ Y138), R61 (= R150), S62 (≠ A151), Y63 (≠ F152), S64 (= S153), L78 (≠ H166), I79 (≠ V167), R80 (= R168), L82 (≠ V170), F87 (≠ A175), G128 (= G216), N155 (≠ R243), E159 (= E247), S186 (≠ P274), G187 (≠ A275), E242 (= E336), F244 (= F338), L245 (≠ I339)
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
29% identity, 60% coverage: 127:338/355 of query aligns to 179:396/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (= Y138), R206 (= R150), Q207 (≠ A151), Y208 (≠ F152), S209 (= S153), S222 (≠ H166), E226 (≠ V170), Q231 (= Q174), P232 (≠ A175), G234 (= G177), Y235 (= Y178), V236 (vs. gap), S237 (vs. gap), V395 (≠ K337)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 397, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
28% identity, 60% coverage: 125:338/355 of query aligns to 175:390/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (= Y138), R204 (= R150), Q205 (≠ A151), Y206 (≠ F152), S207 (= S153), A220 (≠ H166), V221 (= V167), E224 (≠ V170), G227 (= G173), Q228 (= Q174), V229 (≠ A175), S230 (≠ T176), V269 (≠ S215), T272 (≠ S218), E388 (= E336), F390 (= F338)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
Query Sequence
>RR42_RS32665 FitnessBrowser__Cup4G11:RR42_RS32665
MYSLTIEPIGQTIPIAAGQTVLDACLRNGVWLPHACCHGLCATCKVQVVEGEFEHGEASS
FALMDFERDSGQCLACCATAQSDMVIEADIEEDADSLGLPLADYRAEVVEARALTPTIRG
IWLRVKGGAAAAFQAGQYLNLHVPGCDQPRAFSLANRPGDDLVELHVRRVEGGQATGYLH
DRLSVGDELGFSAPYGRFFVRKSAQKPMLFLAGGSGLSSPRAMILDMLAAGETLPITLVQ
GARNRTELYYDEAFRALAGAHPNFRYVPALSDVPADSGWDGARGYVHDVLHGLYADGATA
DFRGHKAYLCGPPPMIEACIRTLMQGRLFEEDIHTEKFISAGDAQNSARSPLFKI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory