Comparing RR42_RS32880 FitnessBrowser__Cup4G11:RR42_RS32880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
50% identity, 95% coverage: 6:286/295 of query aligns to 12:292/292 of 1tmxA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
50% identity, 95% coverage: 6:286/295 of query aligns to 13:293/293 of Q5PXQ6
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
47% identity, 94% coverage: 6:283/295 of query aligns to 5:283/286 of 3n9tA
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
31% identity, 87% coverage: 22:279/295 of query aligns to 2:242/246 of 3th1A
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 71:258/258 of 3hgiA
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3i51A
Sites not aligning to the query:
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3hjsA
Sites not aligning to the query:
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3hjqA
Sites not aligning to the query:
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 70:257/257 of 3hj8A
Sites not aligning to the query:
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3hhyA
Sites not aligning to the query:
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
35% identity, 66% coverage: 91:286/295 of query aligns to 69:256/256 of 3hhxA
Sites not aligning to the query:
1dmhA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound 4-methylcatechol (see paper)
29% identity, 89% coverage: 22:283/295 of query aligns to 25:290/309 of 1dmhA
1dltA Structure of catechol 1,2-dioxygenase from acinetobacter sp. Adp1 with bound catechol (see paper)
29% identity, 89% coverage: 22:283/295 of query aligns to 25:290/309 of 1dltA
1dlmA Structure of catechol 1,2-dioxygenase from acinetobacter calcoaceticus native data (see paper)
29% identity, 89% coverage: 22:283/295 of query aligns to 25:290/309 of 1dlmA
P07773 Catechol 1,2-dioxygenase; 1,2-CTD; EC 1.13.11.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see paper)
29% identity, 89% coverage: 22:283/295 of query aligns to 27:292/311 of P07773
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
28% identity, 82% coverage: 24:265/295 of query aligns to 4:240/253 of 2boyA
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
29% identity, 92% coverage: 24:294/295 of query aligns to 27:299/309 of 2azqA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
27% identity, 95% coverage: 7:285/295 of query aligns to 11:291/310 of 5umhB
>RR42_RS32880 FitnessBrowser__Cup4G11:RR42_RS32880
MRNLDEETITQAVLARHADMPNGRMKEIMTSLVQHLHAFAREVHLTEAEWAEGIKFLTEV
GHTCTSSRQEFILLSDTLGLSTLVTAQNHKKPRGCTEATVFGPFYVDDAPEYELGADVAN
GMTGEPCYVSGKVKSVTGEAVPNARLEVWQADSEGFYDVQQAGLDGHQGRGTLTADERGG
FHFKSIVAECYPIPHDGPVGRMLDAMGRHPWRPAHLHFMISAPGFETLITHVFREGGEYL
DSDAVFGVRSSLIGDWVRHEAGTAPDGTSSATPFYTLDFDFILNPAPAAPAPSRR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory