Comparing RR42_RS32885 FitnessBrowser__Cup4G11:RR42_RS32885 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
37% identity, 83% coverage: 37:301/321 of query aligns to 11:274/274 of 2ioyA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
35% identity, 81% coverage: 25:284/321 of query aligns to 1:268/287 of 5dteB
A0QYB5 D-threitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
31% identity, 93% coverage: 11:310/321 of query aligns to 19:318/349 of A0QYB5
4rsmA Crystal structure of carbohydrate transporter msmeg_3599 from mycobacterium smegmatis str. Mc2 155, target efi-510970, in complex with d-threitol (see paper)
30% identity, 89% coverage: 25:310/321 of query aligns to 1:286/315 of 4rsmA
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
30% identity, 85% coverage: 28:301/321 of query aligns to 10:280/284 of 7e7mC
A0QYB3 Xylitol-binding protein from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
30% identity, 93% coverage: 14:310/321 of query aligns to 22:318/349 of A0QYB3
4rs3A Crystal structure of carbohydrate transporter a0qyb3 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with xylitol (see paper)
30% identity, 88% coverage: 27:310/321 of query aligns to 2:285/315 of 4rs3A
5hkoA Crystal structure of abc transporter solute binding protein msmeg_3598 from mycobacterium smegmatis str. Mc2 155, target efi-510969, in complex with l-sorbitol
30% identity, 88% coverage: 27:310/321 of query aligns to 2:285/314 of 5hkoA
4zjpA Structure of an abc-transporter solute binding protein (sbp_ipr025997) from actinobacillus succinogenes (asuc_0197, target efi-511067) with bound beta-d-ribopyranose
32% identity, 84% coverage: 27:295/321 of query aligns to 3:268/270 of 4zjpA
2rjoA Crystal structure of twin-arginine translocation pathway signal protein from burkholderia phytofirmans
31% identity, 90% coverage: 29:316/321 of query aligns to 6:307/322 of 2rjoA
1dbpA Identical mutations at corresponding positions in two homologous proteins with non-identical effects (see paper)
32% identity, 80% coverage: 27:284/321 of query aligns to 2:257/271 of 1dbpA
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
32% identity, 76% coverage: 30:272/321 of query aligns to 5:257/288 of 1rpjA
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
32% identity, 76% coverage: 30:272/321 of query aligns to 5:257/288 of 1gudA
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
35% identity, 77% coverage: 29:275/321 of query aligns to 5:251/287 of 5ibqA
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
35% identity, 77% coverage: 29:275/321 of query aligns to 5:251/287 of 4ry0A
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
31% identity, 72% coverage: 30:259/321 of query aligns to 5:244/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
31% identity, 72% coverage: 30:259/321 of query aligns to 5:244/288 of 8wl9A
Sites not aligning to the query:
4yo7A Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi- 511484) with bound myo-inositol
29% identity, 72% coverage: 72:302/321 of query aligns to 50:282/287 of 4yo7A
Sites not aligning to the query:
6hyhA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with beta-d-fucofuranose (see paper)
33% identity, 70% coverage: 72:297/321 of query aligns to 45:279/304 of 6hyhA
Sites not aligning to the query:
6hbmA Crystal structure of msmeg_1712 from mycobacterium smegmatis in complex with alpha-l-arabinofuranose (see paper)
33% identity, 70% coverage: 72:297/321 of query aligns to 45:279/304 of 6hbmA
Sites not aligning to the query:
>RR42_RS32885 FitnessBrowser__Cup4G11:RR42_RS32885
MNVRNLKPLAGLLALGILAAPAHADGERIAVFTKNQTNPFFQVVRQGADAAAKSMNARVT
HYIPTKPDSIPEQMSQIEDVIVKKADAIVFVPVDYKAMGPGVKKINAANIPVVNVTDKSD
VGNFVSFIGASDYDLGLKTATHLFKAMGGKGNVVLLEGIKGSLTNIDRVRGMHDALKAFP
GIKLVASQPANYQRLQALQVMENLMQSYPQIDAIFATNDAMAIGAIEALQGANRKALVSG
INGTQEAIDAIKAGTMLATGDYNGFAQGCLGMTAAIRKLRGMPVTQSIVLPATVVDKTNY
QSIDIPVSKRACPRWEDAAKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory