Comparing RR42_RS32900 FitnessBrowser__Cup4G11:RR42_RS32900 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
42% identity, 97% coverage: 10:495/502 of query aligns to 4:488/501 of P04983
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 55% coverage: 17:290/502 of query aligns to 11:254/348 of 3d31A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
27% identity, 47% coverage: 5:240/502 of query aligns to 12:235/378 of P69874
Sites not aligning to the query:
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 14:225/502 of query aligns to 8:227/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
29% identity, 42% coverage: 14:225/502 of query aligns to 8:227/254 of 1g6hA
P75831 Macrolide export ATP-binding/permease protein MacB; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 44% coverage: 7:227/502 of query aligns to 1:222/648 of P75831
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 47% coverage: 13:246/502 of query aligns to 6:242/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 47% coverage: 13:246/502 of query aligns to 6:242/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
32% identity, 47% coverage: 13:246/502 of query aligns to 6:242/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
32% identity, 47% coverage: 13:246/502 of query aligns to 6:242/353 of Q97UY8
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
27% identity, 45% coverage: 16:243/502 of query aligns to 7:226/240 of 4ymuJ
8hprC Lpqy-sugabc in state 4 (see paper)
29% identity, 45% coverage: 16:242/502 of query aligns to 8:223/363 of 8hprC
8hprD Lpqy-sugabc in state 4 (see paper)
29% identity, 45% coverage: 16:242/502 of query aligns to 8:223/362 of 8hprD
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 45% coverage: 10:234/502 of query aligns to 3:224/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 45% coverage: 10:234/502 of query aligns to 3:224/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 45% coverage: 10:234/502 of query aligns to 3:224/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 45% coverage: 10:234/502 of query aligns to 3:224/242 of 2oljA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
26% identity, 47% coverage: 9:243/502 of query aligns to 1:226/241 of 4u00A
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
28% identity, 46% coverage: 15:246/502 of query aligns to 11:236/375 of 2d62A
8hplC Lpqy-sugabc in state 1 (see paper)
29% identity, 45% coverage: 16:242/502 of query aligns to 8:221/384 of 8hplC
>RR42_RS32900 FitnessBrowser__Cup4G11:RR42_RS32900
MNAITEITPLFEMRGICKNFPGVKALDDVSFAIYPGEVHMLLGENGAGKSSLMKVLCGVY
VADAGEFYHDGSPVAITSPADTMGLGIAVIFQEFSLVPYLDIAQNIFLGREPRGRIPGSV
DAARMHAEARRILDILGMEVSTRTPVHRLGVAQQQMVEIAKALSQNARILVLDEPTAALS
DRETEKLFAVIARLKADGVSMIYISHRMAEVFALGDRITILRDGRKVGACLPGDATPDEL
VARMVGRKVDMSYSRERSAQPGEVALDVRNVSADSGIADINLQVRAGEIVGLAGLVGSGR
SEVARAVFGADPIRQGEIYIFGKRLTGGPDRARELGAALIPESRKSEGLALIRTVRDNLL
LAGLRRAFPARWYRADKAEALAEREIARLRIATPDGNQLAQFLSGGNQQKIVIGKWLVAE
AKLFIFDEPTRGIDVGAKAEIFALIDSLVKQGAGVLLISSELPEIINVCDRTYVMRGGRI
AGEVAHAEMTEERILQLGMNDA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory