Comparing RR42_RS33075 FitnessBrowser__Cup4G11:RR42_RS33075 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lbcD D-sialic acid aldolase complexed with l-arabinose
29% identity, 81% coverage: 5:258/313 of query aligns to 4:250/296 of 3lbcD
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
29% identity, 81% coverage: 5:258/313 of query aligns to 5:251/297 of 8u8wA
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
29% identity, 81% coverage: 5:258/313 of query aligns to 1:247/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
29% identity, 81% coverage: 5:258/313 of query aligns to 1:247/292 of 1fdyA
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 81% coverage: 5:258/313 of query aligns to 6:252/299 of 4bwlA
Sites not aligning to the query:
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
29% identity, 81% coverage: 5:258/313 of query aligns to 4:250/296 of 4bwlC
Sites not aligning to the query:
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
28% identity, 81% coverage: 5:258/313 of query aligns to 9:255/302 of 2wpbA
4imfA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-acetylneuraminic acid (see paper)
28% identity, 96% coverage: 5:303/313 of query aligns to 2:287/292 of 4imfA
4imgA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid (see paper)
28% identity, 96% coverage: 5:303/313 of query aligns to 3:288/293 of 4imgA
1f7bA Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
28% identity, 94% coverage: 5:297/313 of query aligns to 3:282/293 of 1f7bA
1f74A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid (see paper)
28% identity, 94% coverage: 5:297/313 of query aligns to 3:282/293 of 1f74A
1f73A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol (see paper)
28% identity, 94% coverage: 5:297/313 of query aligns to 3:277/288 of 1f73A
1f7bC Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
28% identity, 94% coverage: 5:297/313 of query aligns to 3:274/285 of 1f7bC
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
31% identity, 96% coverage: 6:307/313 of query aligns to 2:290/292 of Q07607
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
28% identity, 78% coverage: 8:250/313 of query aligns to 3:238/288 of Q9S4K9
Q2G160 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
24% identity, 81% coverage: 5:258/313 of query aligns to 4:250/293 of Q2G160
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
25% identity, 75% coverage: 6:240/313 of query aligns to 3:234/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
25% identity, 75% coverage: 6:240/313 of query aligns to 3:234/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
25% identity, 75% coverage: 6:240/313 of query aligns to 3:234/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
25% identity, 75% coverage: 6:240/313 of query aligns to 3:234/298 of 4oe7B
>RR42_RS33075 FitnessBrowser__Cup4G11:RR42_RS33075
MPDINFHGIIPAIAVPFNADYSINEPELRRFARWLGGQAGVTALMTNGHTGEVFSLTPRE
RAQVTRITADATQGICPVISSVVCEGINDAVEQAGWAKEAGAAGLDIMPPHHWLRFGFKP
EHCLDYFNAIGKASGLPLVVHIYPAWTRGSYSSELLAELAKLPYVKAFKMGEREMNKYAR
DIKEIRAADPTKVLMTCHDEYLLSSMVQGIDGALVGFASLIPGLINDLLKAVKAGDLHEA
MRVQALINPLKDAVYGAGEPTGEAHGRMKAAMALAGILRDGTVRPPTHAPSAAELAAIRA
ALEHAGVTRQVAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory