SitesBLAST
Comparing RR42_RS33640 FitnessBrowser__Cup4G11:RR42_RS33640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P00370 NADP-specific glutamate dehydrogenase; NADP-GDH; EC 1.4.1.4 from Escherichia coli (strain K12) (see 2 papers)
69% identity, 99% coverage: 5:447/447 of query aligns to 6:447/447 of P00370
- K92 (= K91) mutation to S: Complete loss of dehydrogenase activity.
- K128 (= K127) mutation to H: Reduces catalytic activity and increases pH optima for activity. Increases relative activity with amino acid substrates other than glutamate, especially L-norvaline.; mutation to R: Reduced catalytic activity and increases pH optima for activity. NADP-specific glutamate dehydrogenase.
5ijzA Crystal structure of glutamate dehydrogenase(gdh) from corynebacterium glutamicum (see paper)
56% identity, 97% coverage: 15:447/447 of query aligns to 16:447/447 of 5ijzA
- active site: K128 (= K127), D168 (= D167)
- binding 2-oxoglutaric acid: K92 (= K91), G93 (= G92), G94 (= G93), Q113 (= Q112), K116 (= K115), K128 (= K127), A166 (= A165), R208 (= R206), V376 (= V376), S379 (= S379)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K136 (= K135), D168 (= D167), I169 (= I168), T212 (= T210), S241 (= S239), G242 (= G240), N243 (= N241), V244 (= V242), D264 (= D262), S265 (= S263), R290 (= R291), A321 (= A321), T322 (= T322), A346 (= A346), N347 (= N347), N372 (= N372)
5gudA Glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/NADP+ complex) (see paper)
56% identity, 97% coverage: 15:447/447 of query aligns to 16:447/447 of 5gudA
- active site: K128 (= K127), D168 (= D167)
- binding (2Z)-2-iminopentanedioic acid: K92 (= K91), G93 (= G92), G94 (= G93), Q113 (= Q112), K116 (= K115), K128 (= K127), A166 (= A165), R208 (= R206), V376 (= V376), S379 (= S379)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K136 (= K135), D168 (= D167), I169 (= I168), R208 (= R206), T212 (= T210), S241 (= S239), G242 (= G240), N243 (= N241), V244 (= V242), D264 (= D262), S265 (= S263), R290 (= R291), A321 (= A321), T322 (= T322), G345 (= G345), A346 (= A346), N347 (= N347), N372 (= N372)
5gudE Glutamate dehydrogenase from corynebacterium glutamicum (alpha- iminoglutarate/NADP+ complex) (see paper)
56% identity, 97% coverage: 15:447/447 of query aligns to 29:460/460 of 5gudE
- active site: K141 (= K127), D181 (= D167)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: T225 (= T210), S254 (= S239), G255 (= G240), N256 (= N241), V257 (= V242), D277 (= D262), S278 (= S263), R303 (= R291), A334 (= A321), T335 (= T322), A359 (= A346), N360 (= N347)
1bgvA Glutamate dehydrogenase (see paper)
52% identity, 99% coverage: 3:446/447 of query aligns to 1:447/449 of 1bgvA
P24295 NAD-specific glutamate dehydrogenase; NAD-GDH; EC 1.4.1.2 from Clostridium symbiosum (Bacteroides symbiosus) (see 4 papers)
52% identity, 99% coverage: 3:446/447 of query aligns to 2:448/450 of P24295
- K90 (= K91) binding ; mutation to L: Increased substrate activity for methionine and norleucine but negligible activity with either glutamate or leucine. Dramatic reduction in the dehydrogenase activity with glutamate as the substrate; when associated with V-381.
- Q111 (= Q112) binding
- K114 (= K115) binding
- K126 (= K127) active site, Proton donor
- G165 (= G166) binding
- D166 (= D167) mutation to S: Dramatic reduction in the dehydrogenase activity. Specific activity is decreased 1000-fold in the reductive amination reaction and 100000-fold for oxidative deamination.
- S381 (= S379) binding ; mutation to V: Dramatic reduction in the dehydrogenase activity with glutamate as the substrate; when associated with L-90.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
P00369 NADP-specific glutamate dehydrogenase; NADP-GDH; NADP-dependent glutamate dehydrogenase; EC 1.4.1.4 from Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) (see paper)
56% identity, 96% coverage: 18:445/447 of query aligns to 5:448/454 of P00369
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
7f79C Crystal structure of glutamate dehydrogenase 3 from candida albicans in complex with alpha-ketoglutarate and NADPH (see paper)
50% identity, 96% coverage: 18:447/447 of query aligns to 6:457/458 of 7f79C
- binding 2-oxoglutaric acid: K79 (= K91), G80 (= G92), G81 (= G93), Q100 (= Q112), K103 (= K115), K115 (= K127), V380 (= V376), S383 (= S379)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R83 (= R95), H85 (= H97), K123 (= K135), D155 (= D167), I156 (= I168), R194 (= R206), T198 (= T210), S230 (= S239), G231 (= G240), N232 (= N241), V233 (= V242), D253 (= D262), S254 (= S263), K276 (= K285), A321 (= A321), T322 (= T322), G345 (= G345), S346 (≠ A346), N347 (= N347), N376 (= N372)
7ecsA Crystal structure of aspergillus terreus glutamate dehydrogenase (atgdh) complexed with malonate and NADPH (see paper)
54% identity, 96% coverage: 18:445/447 of query aligns to 5:457/460 of 7ecsA
- binding malonate ion: G79 (= G92), G80 (= G93), Q99 (= Q112), K102 (= K115), K114 (= K127), S326 (≠ D327), G327 (= G328), E328 (≠ N329), T350 (= T351), A352 (≠ D353)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K122 (= K135), D154 (= D167), I155 (= I168), R193 (= R206), T197 (= T210), S229 (= S239), G230 (= G240), N231 (= N241), V232 (= V242), D252 (= D262), S253 (= S263), K279 (= K285), A320 (= A321), T321 (= T322), G344 (= G345), S345 (≠ A346), N346 (= N347), N379 (= N372)
7ecrA Crystal structure of aspergillus terreus glutamate dehydrogenase (atgdh) complexed with succinate and adp-ribose (see paper)
54% identity, 96% coverage: 18:445/447 of query aligns to 5:457/460 of 7ecrA
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4r,5r)-3,4,5-trihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: K122 (= K135), D154 (= D167), I155 (= I168), S229 (= S239), G230 (= G240), N231 (= N241), V232 (= V242), D252 (= D262), S253 (= S263), K279 (= K285), A320 (= A321), T321 (= T322), G344 (= G345), S345 (≠ A346), N346 (= N347), N379 (= N372)
5xwcA Crystal structure of aspergillus niger glutamate dehydrogenase complexed with alpha-iminoglutarate, 2-amino-2-hydroxyglutarate and NADP (see paper)
53% identity, 96% coverage: 18:445/447 of query aligns to 4:456/459 of 5xwcA
- binding (2Z)-2-iminopentanedioic acid: K77 (= K91), G78 (= G92), Q98 (= Q112), K101 (= K115), K113 (= K127), A151 (= A165), R192 (= R206), V382 (= V376), S385 (= S379)
- binding (2S)-2-azanyl-2-oxidanyl-pentanedioic acid: K77 (= K91), G78 (= G92), G79 (= G93), Q98 (= Q112), K101 (= K115), K113 (= K127), A151 (= A165), D153 (= D167), R192 (= R206), V382 (= V376), S385 (= S379)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: H83 (= H97), K121 (= K135), D153 (= D167), I154 (= I168), R192 (= R206), T196 (= T210), S228 (= S239), G229 (= G240), N230 (= N241), V231 (= V242), D251 (= D262), S252 (= S263), A319 (= A321), T320 (= T322), G343 (= G345), S344 (≠ A346), N345 (= N347), N378 (= N372)
5xw0A Crystal structure of aspergillus niger glutamate dehydrogenase complexed with isophthalate and NADPH (see paper)
53% identity, 96% coverage: 18:445/447 of query aligns to 4:456/459 of 5xw0A
- binding benzene-1,3-dicarboxylic acid: K77 (= K91), G78 (= G92), Q98 (= Q112), K101 (= K115), K113 (= K127), A151 (= A165), G152 (= G166), D153 (= D167), R192 (= R206), S385 (= S379)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: H83 (= H97), K121 (= K135), D153 (= D167), I154 (= I168), R192 (= R206), T196 (= T210), S228 (= S239), G229 (= G240), N230 (= N241), V231 (= V242), D251 (= D262), S252 (= S263), A319 (= A321), T320 (= T322), G343 (= G345), S344 (≠ A346), N345 (= N347), N378 (= N372)
5xvxA Crystal structure of aspergillus niger glutamate dehydrogenase complexed with alpha-ketoglutarate and NADPH (see paper)
53% identity, 96% coverage: 18:445/447 of query aligns to 4:456/459 of 5xvxA
- binding 2-oxoglutaric acid: K77 (= K91), Q98 (= Q112), K101 (= K115), K113 (= K127), A151 (= A165), R192 (= R206), V382 (= V376), S385 (= S379)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K121 (= K135), D153 (= D167), I154 (= I168), R192 (= R206), T196 (= T210), S228 (= S239), G229 (= G240), N230 (= N241), V231 (= V242), D251 (= D262), S252 (= S263), A319 (= A321), T320 (= T322), G343 (= G345), S344 (≠ A346), N345 (= N347), N378 (= N372)
5xvvB Crystal structure of forward inhibited aspergillus niger glutamate dehydrogenase with both apo- and alpha ketoglutarate bound subunits (see paper)
53% identity, 96% coverage: 18:445/447 of query aligns to 4:456/459 of 5xvvB
P78804 NADP-specific glutamate dehydrogenase; NADP-GDH; NADP-dependent glutamate dehydrogenase; EC 1.4.1.4 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
51% identity, 96% coverage: 18:445/447 of query aligns to 4:448/451 of P78804
- S252 (= S263) modified: Phosphoserine
8xcoA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus incorporating NADPH in the initial stage of reaction
34% identity, 91% coverage: 40:447/447 of query aligns to 16:414/416 of 8xcoA
8xcsA Cryo-em structure of glutamate dehydrogenase from thermococcus profundus in complex with NADPH, akg and nh4 in the initial stage of reaction
34% identity, 91% coverage: 40:447/447 of query aligns to 18:416/418 of 8xcsA
- binding 2-oxoglutaric acid: K68 (= K91), G70 (= G93), M89 (≠ Q112), K92 (= K115), K104 (= K127), A142 (= A165), D144 (= D167), G346 (= G375), S350 (= S379)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: R72 (= R95), K112 (= K135), P143 (≠ G166), D144 (= D167), V145 (≠ I168), Y146 (≠ G169), T190 (= T210), Y219 (≠ S239), G220 (= G240), N221 (= N241), A222 (≠ V242), D243 (= D262), S244 (= S263), K263 (= K285), A295 (= A321), I296 (≠ T322), N318 (= N347)
8xd5A Cryo-em structure of glutamate dehydrogenase from thermococcus profundus in complex with NADP and glu in the steady stage of reaction
34% identity, 91% coverage: 40:447/447 of query aligns to 19:417/419 of 8xd5A
- binding gamma-l-glutamic acid: K69 (= K91), M90 (≠ Q112), K105 (= K127), A143 (= A165), D145 (= D167), S351 (= S379)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R73 (= R95), D145 (= D167), V146 (≠ I168), Y147 (≠ G169), T191 (= T210), Y220 (≠ S239), G221 (= G240), N222 (= N241), A223 (≠ V242), D244 (= D262), S245 (= S263), K264 (= K285), N281 (≠ F303), A295 (≠ C320), A296 (= A321), I297 (≠ T322), N319 (= N347), N344 (= N372)
P39633 Catabolic NAD-specific glutamate dehydrogenase RocG; NAD-GDH; Glutamate dehydrogenase; GlutDH; Trigger enzyme RocG; EC 1.4.1.2 from Bacillus subtilis (strain 168) (see 2 papers)
32% identity, 80% coverage: 49:405/447 of query aligns to 38:384/424 of P39633
- E93 (≠ V104) mutation to K: Reduces the affinity for glutamate and ammonium.
- D122 (= D133) mutation to N: Unable to control gltAB expression via an inhibitory interactions with the transcriptional regulator GltC. Reduces the affinity for glutamate and ammonium.
- Q144 (≠ R155) mutation to R: Increase of thermostability 20 degrees Celsius higher than that of the wild-type.
- Y158 (≠ G169) mutation to H: Reduces the affinity for glutamate and ammonium.
- S234 (≠ Q244) mutation to R: Reduces the affinity for glutamate and ammonium.
- A324 (≠ G345) mutation to R: No effect.
Sites not aligning to the query:
- 27 E→F: Increase of thermostability 8 degrees Celsius higher than that of the wild-type.
4xgiA Crystal structure of glutamate dehydrogenase from burkholderia thailandensis
32% identity, 86% coverage: 23:407/447 of query aligns to 17:377/416 of 4xgiA
- active site: K112 (= K127), D152 (= D167)
- binding 2-oxoglutaric acid: K76 (= K91), G78 (= G93), M97 (≠ Q112), K100 (= K115), K112 (= K127), A150 (= A165), R192 (= R206), S355 (= S379)
- binding nicotinamide-adenine-dinucleotide: R80 (= R95), D152 (= D167), V153 (≠ I168), T196 (= T210), G224 (= G238), G226 (= G240), N227 (= N241), V228 (= V242), D248 (= D262), H249 (≠ S263), A299 (≠ C320), A300 (= A321), A322 (= A346), N323 (= N347), N348 (= N372)
Query Sequence
>RR42_RS33640 FitnessBrowser__Cup4G11:RR42_RS33640
MTSASLETFLAGVARRDPDQPEFLQAVKEVMMTLWPFVEQHPRYGEQALLERLVEPERVI
QFRVAWTDDRGQVQVNRGFRVQHSSAIGPYKGGMRLHPTVNLSVLKFLGFEQTLKNALTT
LPMGGGKGGSDFDPKGKSDGEVMRFCQALMTELYRHLGPDTDVPAGDIGVGAREVGFMAG
MMKKLSNSSASVFTGKGMAFGGSLMRPEATGYGTVYFAQEMLHRRGRDFSGLRVLLSGSG
NVAQYAAEKAIELGAKVLTVSDSGGVLHYPKGMNSEQLSALMAFKNEARGRLAEFAAEQD
LHFEAGRTPWHVPADVALPCATQNELDGNDAERLLANGVFCVAEGANMPATLDAVDRFLA
ARILYAPGKASNAGGVATSGLEMSQNAMRMSWHHAEVDEKLHAIMKDIHGNCIHYGQKAD
GFINYVEGANVAGFVKVADAMLAQGVV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory