SitesBLAST
Comparing RR42_RS33745 FitnessBrowser__Cup4G11:RR42_RS33745 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
O59010 Glutamate transporter homolog; Glt(Ph); Sodium-aspartate symporter Glt(Ph); Sodium-dependent aspartate transporter from Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) (see 3 papers)
30% identity, 88% coverage: 12:407/452 of query aligns to 15:421/425 of O59010
- S65 (≠ T56) mutation to V: Strongly decreased chloride conductance.
- R276 (≠ S267) mutation to S: Increased rate of aspartate transport; when associated with R-395.
- RSS 276:278 (≠ SSS 267:269) binding
- M311 (≠ P302) mutation to A: Decreased dependence of aspartate binding on Na(+) concentration.
- T314 (≠ Q305) binding
- V355 (≠ I346) binding
- D394 (≠ S380) binding
- M395 (≠ E381) mutation to R: Increased rate of aspartate transport; when associated with S-276.
- R397 (= R383) mutation to A: Strongly decreased affinity for aspartate.
- N401 (= N387) binding
- D405 (≠ N391) mutation to N: Strongly decreased affinity for aspartate.
6xwnB Structure of glutamate transporter homologue glttk in the presence of tboa inhibitor (see paper)
31% identity, 90% coverage: 1:409/452 of query aligns to 2:423/426 of 6xwnB
5e9sA Crystal structure of substrate-bound glutamate transporter homologue glttk (see paper)
31% identity, 90% coverage: 1:409/452 of query aligns to 2:423/427 of 5e9sA
- binding aspartic acid: R274 (≠ S267), S275 (= S268), S276 (= S269), T313 (≠ Q305), G353 (= G345), V354 (≠ I346), A357 (≠ S349), G358 (= G350), D394 (≠ S380), R397 (= R383), T398 (≠ A384)
- binding decyl-beta-d-maltopyranoside: L194 (≠ A187), G198 (≠ M191), Y202 (≠ V195)
- binding sodium ion: Y87 (≠ F81), T90 (≠ L84), S91 (= S85), S276 (= S269), G305 (= G297), A306 (≠ L298), T307 (= T299), N309 (= N301), N309 (= N301), M310 (≠ P302), D311 (= D303), S348 (= S340), I349 (≠ K341), G350 (= G342), T351 (≠ S343), N401 (= N387), V402 (≠ T388), D405 (≠ N391)
6zgbA Glutamate transporter homologue glttk in complex with a photo cage compound (see paper)
31% identity, 90% coverage: 2:409/452 of query aligns to 1:421/425 of 6zgbA
6zl4A The structure of glutamate transporter homologue glttk in complex with the photo switchable compound (cis) (see paper)
31% identity, 88% coverage: 12:409/452 of query aligns to 10:420/424 of 6zl4A
- binding decyl-beta-d-maltopyranoside: L191 (≠ A187), G195 (≠ M191), R282 (= R278)
- binding (2~{S},3~{S})-2-azanyl-3-[[4-[2-(4-methoxyphenyl)hydrazinyl]phenyl]methoxy]butanedioic acid: R271 (≠ S267), S272 (= S268), S273 (= S269), M307 (≠ P302), T310 (≠ Q305), G353 (= G348), A354 (≠ S349), R394 (= R383), T395 (≠ A384)
Sites not aligning to the query:
2nwwA Crystal structure of gltph in complex with tboa (see paper)
30% identity, 86% coverage: 12:400/452 of query aligns to 6:405/407 of 2nwwA
6x15A Inward-facing state of the glutamate transporter homologue gltph in complex with l-aspartate and sodium ions (see paper)
30% identity, 87% coverage: 12:405/452 of query aligns to 15:419/419 of 6x15A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: F46 (≠ L37), F46 (≠ L37), P75 (≠ S66), L91 (≠ V83), F95 (= F87), L130 (≠ I129), I133 (≠ F132), I159 (≠ V158), Y167 (≠ H166), K196 (≠ A187), G200 (≠ M191), I207 (≠ V198), F210 (= F201), L250 (≠ I241), I262 (≠ L253), M269 (≠ I260), T334 (= T325), V335 (≠ L326), G336 (≠ T327), T340 (≠ V331), L343 (≠ G334), M399 (≠ I385)
- binding aspartic acid: S277 (= S268), S278 (= S269), T314 (≠ Q305), G354 (= G345), A358 (≠ S349), G359 (= G350), D394 (≠ S380), R397 (= R383), T398 (≠ A384)
- binding sodium ion: Y89 (≠ F81), T92 (≠ L84), S93 (= S85), G306 (= G297), T308 (= T299), N310 (= N301), N310 (= N301), M311 (≠ P302), D312 (= D303), S349 (= S340), I350 (≠ K341), T352 (≠ S343), N401 (= N387), V402 (≠ T388), D405 (≠ N391)
Sites not aligning to the query:
6x14A Inward-facing state of the glutamate transporter homologue gltph in complex with tfb-tboa (see paper)
30% identity, 86% coverage: 12:400/452 of query aligns to 12:411/413 of 6x14A
- binding [(2~{R})-1-[2-azanylethoxy(oxidanyl)phosphoryl]oxy-3-hexadecanoyloxy-propan-2-yl] (~{Z})-octadec-9-enoate: G66 (= G60), V83 (≠ L78), I157 (≠ F159), Y164 (≠ H166), K193 (≠ A187), T305 (= T299), I306 (≠ F300), I347 (≠ K341)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I13 (≠ V13), M199 (= M193), S275 (= S269), T311 (≠ Q305), G356 (= G350), L384 (= L373), D391 (≠ S380), R394 (= R383)
Sites not aligning to the query:
6r7rA Crystal structure of the glutamate transporter homologue glttk in complex with d-aspartate (see paper)
31% identity, 88% coverage: 12:409/452 of query aligns to 6:412/416 of 6r7rA
- binding d-aspartic acid: R263 (≠ S267), S265 (= S269), M299 (≠ P302), T302 (≠ Q305), T340 (≠ S343), G342 (= G345), V343 (≠ I346), G347 (= G350), D383 (≠ S380), R386 (= R383), T387 (≠ A384), N390 (= N387)
- binding decyl-beta-d-maltopyranoside: H23 (= H29), V212 (≠ I216), A216 (≠ G220)
6bavA Crystal structure of gltph r397c in complex with s-benzyl-l-cysteine (see paper)
30% identity, 87% coverage: 12:403/452 of query aligns to 7:409/409 of 6bavA
6bauA Crystal structure of gltph r397c in complex with l-cysteine (see paper)
30% identity, 86% coverage: 12:400/452 of query aligns to 7:406/408 of 6bauA
- binding cysteine: S270 (= S269), M303 (≠ P302), T306 (≠ Q305), A345 (= A344), G346 (= G345), V347 (≠ I346), G351 (= G350), D386 (≠ S380), C389 (≠ R383), T390 (≠ A384), N393 (= N387)
6bmiA Crystal structure of gltph r397c in complex with l-serine (see paper)
29% identity, 86% coverage: 12:400/452 of query aligns to 7:394/396 of 6bmiA
7awmA Structure of the thermostabilized eaat1 cryst mutant in complex with l-asp, three sodium ions and the allosteric inhibitor ucph101 (see paper)
30% identity, 79% coverage: 38:393/452 of query aligns to 57:393/412 of 7awmA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: S88 (≠ L70), G89 (= G71), G92 (= G74), A95 (= A77), V96 (≠ L78), Y99 (≠ F81), M163 (≠ V158), F167 (≠ V162), F293 (≠ L292), V297 (≠ A296)
- binding aspartic acid: S268 (= S268), S269 (= S269), T306 (≠ Q305), G346 (= G345), I347 (= I346), A350 (≠ S349), G351 (= G350), D380 (≠ S380), R383 (= R383), T384 (≠ A384)
5mjuA Structure of the thermostabilized eaat1 cryst mutant in complex with the competititve inhibitor tfb-tboa and the allosteric inhibitor ucph101 (see paper)
30% identity, 79% coverage: 38:393/452 of query aligns to 49:379/397 of 5mjuA
- binding 2-Amino-5,6,7,8-tetrahydro-4-(4-methoxyphenyl)-7-(naphthalen-1-yl)-5-oxo-4H-chromene-3-carbonitrile: L72 (≠ I61), S80 (≠ L70), G81 (= G71), G84 (= G74), Y91 (≠ F81), M156 (≠ V158), F160 (≠ V162), F286 (≠ L292), V290 (≠ A296)
- binding (2~{S},3~{S})-2-azanyl-3-[[3-[[4-(trifluoromethyl)phenyl]carbonylamino]phenyl]methoxy]butanedioic acid: I64 (= I53), I148 (= I150), S262 (= S269), S263 (≠ E270), A292 (≠ L298), T293 (= T299), M296 (≠ P302), T299 (≠ Q305), G329 (= G342), A336 (≠ S349), G337 (= G350), D366 (≠ S380), R369 (= R383), N373 (= N387)
O35874 Neutral amino acid transporter A; Alanine/serine/cysteine/threonine transporter 1; ASCT-1; Solute carrier family 1 member 4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 85% coverage: 38:421/452 of query aligns to 79:505/532 of O35874
- N201 (= N148) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P56564 Excitatory amino acid transporter 1; Glial high affinity glutamate transporter; High-affinity neuronal glutamate transporter; GluT-1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Mus musculus (Mouse) (see paper)
24% identity, 89% coverage: 38:440/452 of query aligns to 85:536/543 of P56564
- N206 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
- N216 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
7vr7A Inward-facing structure of human eaat2 in the way213613-bound state (see paper)
27% identity, 79% coverage: 38:392/452 of query aligns to 39:389/402 of 7vr7A
- binding (3beta,14beta,17beta,25R)-3-[4-methoxy-3-(methoxymethyl)butoxy]spirost-5-en: S57 (≠ T56), L58 (≠ V57), L65 (≠ M64), V339 (≠ K341), G340 (= G342), S343 (≠ G345), I344 (= I346)
- binding cholesterol: W188 (≠ R194), I227 (vs. gap), F250 (≠ L253), W257 (≠ I260), M379 (≠ A382), S382 (≠ I385)
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S266 (= S269), M300 (≠ P302), T303 (≠ Q305), Y306 (= Y308), G348 (= G350), L349 (≠ F351), M352 (≠ L354), I366 (≠ M369), L369 (= L372), V370 (≠ L373), D373 (= D376), D377 (≠ S380), R380 (= R383), T381 (≠ A384), N384 (= N387)
Sites not aligning to the query:
P43003 Excitatory amino acid transporter 1; Sodium-dependent glutamate/aspartate transporter 1; GLAST-1; Solute carrier family 1 member 3 from Homo sapiens (Human) (see 3 papers)
24% identity, 88% coverage: 38:433/452 of query aligns to 85:529/542 of P43003
- S363 (= S267) mutation to R: Loss of electrogenic glutamate transport. Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with M-477.
- SSS 363:365 (= SSS 267:269) binding
- T396 (= T299) binding
- T402 (≠ Q305) binding
- IPQAG 443:447 (≠ ITGSG 346:350) binding
- D476 (≠ S380) binding
- R477 (≠ E381) mutation to M: Strongly decreased L-aspartate and L-glutamate uptake combined with strongly increased permeability ot other ions; when associated with R-363.
- N483 (= N387) binding
- Y523 (= Y427) mutation to F: No effect on activity.
7xr6A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with way-213613 (see paper)
27% identity, 79% coverage: 38:392/452 of query aligns to 47:404/424 of 7xr6A
- binding (2S)-2-azanyl-4-[[4-[2-bromanyl-4,5-bis(fluoranyl)phenoxy]phenyl]amino]-4-oxidanylidene-butanoic acid: S280 (= S268), S281 (= S269), T318 (≠ Q305), G363 (= G350), M367 (≠ L354), V385 (≠ L373), D388 (= D376), R395 (= R383), T396 (≠ A384)
- binding dodecyl beta-D-glucopyranoside: W389 (≠ R377)
- binding cholesterol hemisuccinate: R80 (= R72), R84 (= R76), I95 (≠ F87), I252 (≠ V237)
Sites not aligning to the query:
7xr4A Structure of human excitatory amino acid transporter 2 (eaat2) in complex with glutamate (see paper)
27% identity, 79% coverage: 38:392/452 of query aligns to 46:405/425 of 7xr4A
Query Sequence
>RR42_RS33745 FitnessBrowser__Cup4G11:RR42_RS33745
MKRRLISSLYVQVLIAVAAGILLGIFMPHIGSALKPLGDIFIRLIKMVFAPIIFATVVLG
IAKMESMKDLGRVGWRALLYFEVLSTFALLLGVIVVNVVQPGHGMNVDPATLDTKSIAAY
TAQVKHEGIMDFLLNLVPMSIMDALAKNDILQILVFSVFMGVALAHLGERGKPFVAALDS
FANAMFAIVGMIMRVAPVAAFGAMSFTVGKYGFGSIASLGKLVATMYGTCALFVLIVLGA
ICRICGFGLFNFLKYIKDEILTVLGTSSSESVIPQLMRKLENVGVSKPVVGLVVPAGLTF
NPDGQCIYYTMAAIFIAQATNTPLTLTDQFVVLGVLLLTSKGSAGITGSGFITLAATLAS
LGKIPVAGMVLLLGVDRFMSEARAITNTIGNAVATMAIAKWVGALDEDRVQRVLNGEVDP
EDLEQLYEGVAPEPIPLVPLPPNYAADARKSA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory