Comparing RR42_RS33800 FitnessBrowser__Cup4G11:RR42_RS33800 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
P00099 Cytochrome c-551; Cytochrome C8; Cytochrome c551 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 4 papers)
49% identity, 38% coverage: 140:224/224 of query aligns to 20:103/104 of P00099
Sites not aligning to the query:
351cA Structure of cytochrome c551 from p. Aeruginosa refined at 1.6 angstroms resolution and comparison of the two redox forms (see paper)
50% identity, 37% coverage: 143:224/224 of query aligns to 1:81/82 of 351cA
2exvA Crystal structure of the f7a mutant of the cytochrome c551 from pseudomonas aeruginosa (see paper)
50% identity, 37% coverage: 143:224/224 of query aligns to 1:81/82 of 2exvA
1corA Investigation of the solution conformation of cytochromE C-551 from pseudomonas stutzeri (see paper)
52% identity, 37% coverage: 143:224/224 of query aligns to 1:81/82 of 1corA
6kq1A Crystal structure of cytochrome c551 from pseudomonas sp. Strain mt-1.
51% identity, 36% coverage: 143:222/224 of query aligns to 1:79/82 of 6kq1A
1a56A Primary sequence and solution conformation of ferricytochromE C-552 from nitrosomonas europaea, nmr, mean structure refined with explicit hydrogen bond constraints (see paper)
49% identity, 33% coverage: 148:222/224 of query aligns to 4:78/81 of 1a56A
2blfB Sulfite dehydrogenase from starkeya novella (see paper)
47% identity, 35% coverage: 35:113/224 of query aligns to 3:81/81 of 2blfB
5xecA Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
48% identity, 36% coverage: 143:222/224 of query aligns to 1:79/82 of 5xecA
2d0sA Crystal structure of the cytochrome c552 from moderate thermophilic bacterium, hydrogenophilus thermoluteolus (see paper)
43% identity, 34% coverage: 146:222/224 of query aligns to 2:76/79 of 2d0sA
5xecC Heterodimer constructed from pa cyt c551-ht cyt c552 and ht cyt c552- pa cyt c551 chimeric proteins (see paper)
47% identity, 35% coverage: 146:224/224 of query aligns to 2:79/80 of 5xecC
1cchA The solution conformation of cytochromE C-551 from p.Stutzeri zobell determined by nmr+ (see paper)
49% identity, 36% coverage: 143:222/224 of query aligns to 1:79/82 of 1cchA
5aurA Hydrogenobacter thermophilus cytochrome c552 dimer formed by domain swapping at n-terminal region (see paper)
43% identity, 34% coverage: 146:222/224 of query aligns to 2:80/83 of 5aurA
4xxlA Crystal structure of class 1 cytochrome mtod from sideroxydans lithotrophicus es-1 (see paper)
30% identity, 34% coverage: 146:222/224 of query aligns to 8:88/92 of 4xxlA
>RR42_RS33800 FitnessBrowser__Cup4G11:RR42_RS33800
MKEAVMQYAKPLRRHGGIVALALYAAGMTSAAQALEITLPPETARYTPSDLPGFRLVQQN
CMTCHSAQYVLTQPPSSPRGYWEATVKKMKKPFGAPFADEDIPAMVDYLTKTYGAERTAY
AAASAAQGSAPAPAAPAVVAGSHDPQALLAANGCTACHAVDKKVVGPAFKEVAAKYANQP
GAAALVAQNIRAGGAGKWGQVPMPAYAALTKEDLQSLAGWILGR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory