SitesBLAST
Comparing RR42_RS33875 FitnessBrowser__Cup4G11:RR42_RS33875 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 38% coverage: 69:233/436 of query aligns to 88:259/583 of Q9Y7Q9
Sites not aligning to the query:
- 267 modified: Phosphoserine
- 269 modified: Phosphoserine
- 289 modified: Phosphoserine
- 290 modified: Phosphoserine
- 292 modified: Phosphoserine
- 330 modified: Phosphoserine
Q9LT15 Sugar transport protein 10; AtSTP10; D-glucose-H(+) symport protein STP10; D-glucose-proton symporter STP10; Hexose transporter 10 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
30% identity, 36% coverage: 87:241/436 of query aligns to 105:247/514 of Q9LT15
- E162 (= E152) mutation to Q: Abolishes glucose transport activity; when associated with N-344.
- Q177 (= Q174) binding ; mutation to A: Reduces affinity for glucose 37-fold.
- I184 (≠ V182) mutation to A: Reduces affinity for glucose 3-fold.
Sites not aligning to the query:
- 39 F→A: Reduces affinity for glucose 8-fold.
- 43 L→A: Reduces affinity for glucose 150-fold and turns STP10 into a low affinity transporter.
- 77 modified: Disulfide link with 449; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
- 295 binding
- 296 binding
- 301 binding
- 332 binding
- 344 D→N: Abolishes glucose transport activity; when associated with Q-162.
- 410 binding
- 449 modified: Disulfide link with 77; C→A: Increases sensitivity to alkaline pH and can only function fully at acidic pH (pH < 5).
7aaqA Sugar/h+ symporter stp10 in outward occluded conformation (see paper)
30% identity, 36% coverage: 87:241/436 of query aligns to 85:227/487 of 7aaqA
Sites not aligning to the query:
7aarA Sugar/h+ symporter stp10 in inward open conformation (see paper)
29% identity, 36% coverage: 87:241/436 of query aligns to 90:232/485 of 7aarA
- binding Octyl Glucose Neopentyl Glycol : I90 (= I87), H94 (= H91), V98 (≠ T95), F101 (≠ L98), N138 (≠ Y143), P142 (≠ A147), N158 (≠ S163), F161 (≠ G173), Q162 (= Q174), I165 (≠ V178), D210 (≠ E221)
Sites not aligning to the query:
Q9C757 Probable inositol transporter 2 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 36% coverage: 89:245/436 of query aligns to 93:234/580 of Q9C757
Sites not aligning to the query:
- 399 C→A: Strongly decreased nickel inhibition; when associated with A-402, A-410 and A-413.; C→S: No effect on inostol transport or nickel inhibition. No effect on inostol transport or nickel inhibition; when associated with S-410.
- 402 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-410 and A-413.
- 410 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-413.; C→S: No effect on inostol transport or nickel inhibition; when associated with S-399.
- 413 C→A: Strongly decreased nickel inhibition; when associated with A-399, A-402 and A-410.
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 48% coverage: 33:242/436 of query aligns to 45:244/444 of Q8NLB7
- D54 (vs. gap) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- D57 (= D38) mutation to A: Loss of transport activity.; mutation to E: Retains 50% of its transport activity.
- R103 (= R90) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 309 W→V: Loss of transport activity.
- 312 D→A: Loss of transport activity.
- 313 R→A: Loss of transport activity.
- 317 mutation I->H,Y: Loss of transport activity.
- 386 R→A: Loss of transport activity.
O23492 Inositol transporter 4; Myo-inositol-proton symporter INT4; Protein INOSITOL TRANSPORTER 4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
25% identity, 36% coverage: 87:245/436 of query aligns to 90:233/582 of O23492
Sites not aligning to the query:
- 559:561 LLE→AAA: No effect on targeting.
- 559:582 mutation Missing: No effect on targeting.
- 564:565 FK→AA: No effect on targeting.
- 570:575 RRREKK→AAAAAA: No effect on targeting.
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
27% identity, 72% coverage: 85:399/436 of query aligns to 78:406/452 of Q5EXK5
- D82 (= D89) mutation to A: Loss of activity.
- V311 (≠ A303) mutation to W: Loss of activity.
- D314 (= D306) mutation to A: Loss of activity.
Q9Z2I6 Synaptic vesicle glycoprotein 2C; Synaptic vesicle protein 2C from Rattus norvegicus (Rat) (see 3 papers)
33% identity, 19% coverage: 79:160/436 of query aligns to 203:276/727 of Q9Z2I6
Sites not aligning to the query:
- 1:57 Interaction with SYT1
- 529:566 (Microbial infection) C.botulinum neurotoxin type A-binding
- 559 N→A: Loss of one glycosylation site. No effect on C.botulinum neurotoxin type A (BoNT/A, botA) binding, but reduces the uptake of BoNT/A.
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
32% identity, 22% coverage: 85:180/436 of query aligns to 63:150/446 of A0A0H2VG78
- R102 (= R132) mutation to A: Loss of transport activity.
- I105 (≠ Q135) mutation to S: Affects symport activity. May function as an uniporter.
- E122 (= E152) mutation to A: Loss of transport activity.
- Q137 (≠ Y167) mutation to A: Loss of transport activity.
Sites not aligning to the query:
- 22 D→N: Affects symport activity. May function as an uniporter.
- 250 Q→A: Loss of transport activity.
- 251 Q→A: Loss of transport activity.
- 256 N→A: Loss of transport activity.
- 357 W→A: Loss of transport activity.
Q496J9 Synaptic vesicle glycoprotein 2C from Homo sapiens (Human) (see 4 papers)
32% identity, 19% coverage: 79:160/436 of query aligns to 203:276/727 of Q496J9
Sites not aligning to the query:
- 519:563 (Microbial infection) C.botulinum neurotoxin type A-binding
- 534 modified: carbohydrate, N-linked (GlcNAc...) asparagine
- 559 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→A: No change in interaction with C.botulinum neurotoxin type A heavy chain (botA, BoNT/A HC). Decreased molecular weight probably due to glycosylation loss, decreased interaction with BoNT/A HC.; N→Q: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC. Greater reduction in weight; when associated with Q-565.
- 561 S→A: Decreased molecular weight probably due to glycosylation loss, decreased binding to BoNT/A HC.
- 563 F→A: No longer interacts with BoNT/A HC.
- 565 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Decreased molecular weight probably due to glycosylation loss, no change in binding to BoNT/A heavy chain. Greater reduction in weight; when associated with Q-559.
Query Sequence
>RR42_RS33875 FitnessBrowser__Cup4G11:RR42_RS33875
MTDSPRPAPLQPPSPEDIRKRIYAIVAASSGNLVEWFDFYVYAFCAIYFAPSFFPKADPT
AQLLNTAGVFAAGFLMRPIGGWLFGRIADRHGRKTSMLISVLMMCFGSLLIACLPTYGAI
GNWAPALLLLARLLQGLSVGGEYGTTATYMSEIALKGRRGFFSSFQYVTLIGGQLLAVLV
VVVLQQLLDEGQLRSWGWRVPFVIGALTAVVALALRRTLRETSSAATRRNKEAGSLTALF
RHHKAAFLTVLGYTAGGSLIFYTFTTYMQKYLVNSAGMSIKTASTVMTGCLFVYMCMQPL
FGALSDRIGRRSNMLAFGALGTAATVPLLSALQIVSSPLAAFALISIALAIVSLYTSISG
IVKAEMFPPEVRALGVGLAYAISNAIFGGSAEYVALALKSAGHQSAFYWYVTAMMALAFG
VSLRLPRQARHLRHEY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory