SitesBLAST
Comparing RR42_RS33880 FitnessBrowser__Cup4G11:RR42_RS33880 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q8VBT2 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Mus musculus (Mouse)
49% identity, 95% coverage: 11:309/314 of query aligns to 6:315/327 of Q8VBT2
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
1pwhA Rat liver l-serine dehydratase- complex with pyridoxyl-(o-methyl- serine)-5-monophosphate (see paper)
49% identity, 95% coverage: 11:309/314 of query aligns to 6:315/327 of 1pwhA
- active site: K41 (= K46), A65 (≠ G70), E194 (= E196), A198 (= A200), S200 (= S202), A222 (≠ S224), A269 (= A271), C303 (= C297)
- binding n-({3-hydroxy-2-methyl-5-[(phosphonooxy)methyl]pyridin-4-yl}methyl)-o-methyl-l-serine: F40 (= F45), K41 (= K46), S64 (= S69), A65 (≠ G70), N67 (= N72), A68 (= A73), F136 (= F139), G168 (= G170), G169 (= G171), G170 (= G172), G171 (= G173), A222 (≠ S224), G224 (= G226), C303 (= C297), G304 (= G298)
P09367 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Rattus norvegicus (Rat) (see paper)
44% identity, 95% coverage: 11:309/314 of query aligns to 6:351/363 of P09367
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
P20132 L-serine dehydratase/L-threonine deaminase; SDH; L-serine deaminase; L-threonine dehydratase; TDH; EC 4.3.1.17; EC 4.3.1.19 from Homo sapiens (Human) (see paper)
49% identity, 95% coverage: 12:309/314 of query aligns to 7:315/328 of P20132
- C303 (= C297) mutation to A: Loss of enzyme activity.
1p5jA Crystal structure analysis of human serine dehydratase (see paper)
49% identity, 95% coverage: 12:309/314 of query aligns to 4:312/319 of 1p5jA
- active site: K38 (= K46), A62 (≠ G70), E191 (= E196), A195 (= A200), S197 (= S202), A219 (≠ S224), C300 (= C297)
- binding pyridoxal-5'-phosphate: F37 (= F45), K38 (= K46), N64 (= N72), V164 (= V169), G165 (= G170), G166 (= G171), G167 (= G172), G168 (= G173), A219 (≠ S224), C300 (= C297), G301 (= G298), G302 (= G299)
Q96GA7 Serine dehydratase-like; L-serine deaminase; L-serine dehydratase/L-threonine deaminase; L-threonine dehydratase; TDH; Serine dehydratase 2; SDH 2; EC 4.3.1.19; EC 4.3.1.17 from Homo sapiens (Human) (see paper)
49% identity, 98% coverage: 2:309/314 of query aligns to 4:321/329 of Q96GA7
- G72 (= G70) mutation to A: Strongly increased enzyme activity towards threonine.
- C309 (= C297) mutation to A: Loss of enzyme activity.
2rkbA Serine dehydratase like-1 from human cancer cells (see paper)
50% identity, 95% coverage: 12:309/314 of query aligns to 4:311/318 of 2rkbA
- active site: K38 (= K46), G62 (= G70), E190 (= E196), A194 (= A200), C196 (≠ S202), S218 (= S224), A265 (= A271), C299 (= C297)
- binding pyridoxal-5'-phosphate: F37 (= F45), K38 (= K46), N64 (= N72), G164 (= G170), G165 (= G171), G166 (= G172), G167 (= G173), S218 (= S224), C299 (= C297)
5c3uA Crystal structure of a fungal l-serine ammonia-lyase from rhizomucor miehei (see paper)
37% identity, 96% coverage: 11:312/314 of query aligns to 2:312/315 of 5c3uA
- active site: K37 (= K46), G63 (= G70), E191 (= E196), S195 (≠ A200), A197 (≠ S202), S219 (= S224), T297 (≠ C297)
- binding pyridoxal-5'-phosphate: K37 (= K46), N65 (= N72), S132 (≠ F139), P163 (≠ S168), G165 (= G170), G166 (= G171), G167 (= G172), G168 (= G173), S219 (= S224), T297 (≠ C297)
Q7XSN8 Serine racemase; D-serine dehydratase; D-serine ammonia-lyase; L-serine dehydratase; L-serine ammonia-lyase; EC 5.1.1.18; EC 4.3.1.18; EC 4.3.1.17 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 90% coverage: 16:299/314 of query aligns to 38:325/339 of Q7XSN8
- E219 (= E196) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-225.
- D225 (≠ S202) mutation to A: Reduces catalytic activity and abolishes the regulatory effect of Mg(2+) addition; when associated with A-219.
6zspAAA serine racemase bound to atp and malonate. (see paper)
29% identity, 97% coverage: 11:314/314 of query aligns to 19:319/320 of 6zspAAA
- active site: K53 (= K46), S74 (≠ G70), E200 (= E196), A204 (= A200), D206 (≠ S202), G229 (vs. gap), L302 (≠ C297), S303 (≠ G298)
- binding adenosine-5'-triphosphate: S28 (= S21), S29 (≠ T22), I30 (≠ S23), K48 (≠ P41), T49 (≠ P42), Q79 (≠ I75), Y111 (≠ E107), E266 (≠ H264), R267 (= R265), K269 (vs. gap), N306 (≠ G301)
- binding magnesium ion: E200 (= E196), A204 (= A200), D206 (≠ S202)
- binding malonate ion: K53 (= K46), S73 (= S69), S74 (≠ G70), N76 (= N72), H77 (≠ A73), R125 (≠ N122), G229 (vs. gap), S232 (≠ T223)
7nbgAAA structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/322 of 7nbgAAA
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N83 (= N72), G182 (= G170), G183 (= G171), G184 (= G172), G185 (= G173), M186 (≠ L174), G236 (vs. gap), V237 (vs. gap), T282 (≠ A271)
- binding ~{N}-[2-(2-methylphenyl)ethyl]ethanamide: S81 (≠ G70), G85 (= G74), Q86 (≠ I75), I101 (≠ V90), K111 (≠ A100), I115 (= I104), Y118 (≠ E107)
Sites not aligning to the query:
7nbhAAA structure of human serine racemase in complex with DSiP fragment Z26781964, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/320 of 7nbhAAA
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding N-[(1H-benzimidazol-2-yl)methyl]furan-2-carboxamide: S81 (≠ G70), G85 (= G74), Q86 (≠ I75), K111 (≠ A100), I115 (= I104), Y118 (≠ E107), D235 (vs. gap), P281 (= P270)
Sites not aligning to the query:
3l6bA X-ray crystal structure of human serine racemase in complex with malonate a potent inhibitor (see paper)
29% identity, 97% coverage: 11:314/314 of query aligns to 20:322/322 of 3l6bA
- active site: K54 (= K46), S77 (≠ G70), E203 (= E196), A207 (= A200), D209 (≠ S202), G232 (vs. gap), T278 (≠ A271), L305 (≠ C297), S306 (≠ G298)
- binding malonate ion: K54 (= K46), S76 (= S69), S77 (≠ G70), N79 (= N72), H80 (≠ A73), R128 (≠ N122), G232 (vs. gap)
- binding manganese (ii) ion: E203 (= E196), A207 (= A200), D209 (≠ S202)
- binding pyridoxal-5'-phosphate: F53 (= F45), K54 (= K46), N79 (= N72), G178 (= G170), G179 (= G171), G180 (= G172), G181 (= G173), M182 (≠ L174), V233 (vs. gap), E276 (= E269), T278 (≠ A271), S306 (≠ G298), G307 (= G299)
7nbfAAA structure of human serine racemase in complex with DSiP fragment Z126932614, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/323 of 7nbfAAA
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding magnesium ion: N244 (≠ R228)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N83 (= N72), G182 (= G170), G183 (= G171), G184 (= G172), G185 (= G173), M186 (≠ L174), G236 (vs. gap), V237 (vs. gap), T282 (≠ A271)
- binding 2-[(methylsulfonyl)methyl]-1H-benzimidazole: H21 (= H13), L22 (≠ I14), T23 (= T16), P24 (= P17), L26 (= L19), T27 (≠ R20), F46 (≠ L39)
Sites not aligning to the query:
7nbdAAA structure of human serine racemase in complex with DSiP fragment Z235449082, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/323 of 7nbdAAA
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding [4-(1H-benzimidazol-1-yl)phenyl]methanol: W272 (≠ E263), L278 (≠ V267)
- binding magnesium ion: N244 (≠ R228)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N83 (= N72), G182 (= G170), G183 (= G171), G184 (= G172), G185 (= G173), M186 (≠ L174), G236 (vs. gap), V237 (vs. gap), E280 (= E269), T282 (≠ A271)
Sites not aligning to the query:
7nbcCCC structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/323 of 7nbcCCC
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding biphenyl-4-ylacetic acid: T78 (≠ C67), H79 (≠ S68), H84 (≠ A73), V148 (≠ I136), H149 (= H137), P150 (= P138)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N83 (= N72), G182 (= G170), G183 (= G171), G184 (= G172), G185 (= G173), M186 (≠ L174), G236 (vs. gap), V237 (vs. gap), T282 (≠ A271)
Sites not aligning to the query:
7nbcAAA structure of human serine racemase in complex with DSiP fragment Z2856434779, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:290/323 of 7nbcAAA
- active site: K53 (= K46), S81 (≠ G70), E207 (= E196), A211 (= A200), D213 (≠ S202), G236 (vs. gap)
- binding calcium ion: E207 (= E196), A211 (= A200), D213 (≠ S202)
- binding magnesium ion: N244 (≠ R228)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N83 (= N72), G182 (= G170), G183 (= G171), G184 (= G172), G185 (= G173), M186 (≠ L174), G236 (vs. gap), V237 (vs. gap), T282 (≠ A271)
Sites not aligning to the query:
7nbgDDD structure of human serine racemase in complex with DSiP fragment Z52314092, XChem fragment screen (see paper)
30% identity, 86% coverage: 11:279/314 of query aligns to 19:285/310 of 7nbgDDD
- active site: K53 (= K46), S76 (≠ G70), E202 (= E196), A206 (= A200), D208 (≠ S202), G231 (vs. gap)
- binding calcium ion: E202 (= E196), A206 (= A200), D208 (≠ S202)
- binding magnesium ion: N239 (≠ R228)
- binding ortho-xylene: S76 (≠ G70), Q81 (≠ I75), I96 (≠ V90), Y113 (≠ E107)
- binding pyridoxal-5'-phosphate: F52 (= F45), K53 (= K46), N78 (= N72), G177 (= G170), G178 (= G171), G179 (= G172), G180 (= G173), M181 (≠ L174), G231 (vs. gap), V232 (vs. gap), E275 (= E269), T277 (≠ A271)
Sites not aligning to the query:
5cvcA Structure of maize serine racemase (see paper)
29% identity, 90% coverage: 16:299/314 of query aligns to 22:309/329 of 5cvcA
- active site: K52 (= K46), S77 (≠ G70), E203 (= E196), A207 (= A200), D209 (≠ S202), G231 (≠ S224), V306 (= V296), S307 (≠ C297)
- binding magnesium ion: E203 (= E196), A207 (= A200), D209 (≠ S202)
- binding pyridoxal-5'-phosphate: F51 (= F45), K52 (= K46), N79 (= N72), S178 (≠ G170), G179 (= G171), G180 (= G172), G181 (= G173), L232 (= L225), E275 (= E269), S307 (≠ C297), G308 (= G298)
1tdjA Threonine deaminase (biosynthetic) from e. Coli (see paper)
28% identity, 94% coverage: 15:308/314 of query aligns to 27:321/494 of 1tdjA
- active site: K58 (= K46), A83 (≠ G70), E209 (= E196), S213 (≠ A200), C215 (≠ S202), G237 (≠ S224), L310 (≠ C297), S311 (≠ G298)
- binding pyridoxal-5'-phosphate: F57 (= F45), K58 (= K46), N85 (= N72), G184 (= G170), G185 (= G171), G186 (= G172), G187 (= G173), G237 (≠ S224), E282 (= E269), S311 (≠ G298), G312 (= G299)
Query Sequence
>RR42_RS33880 FitnessBrowser__Cup4G11:RR42_RS33880
MPHANNALPASLHIVTPLLRSTSFSARLGRSVWFKMEALQPPGSFKARGIGHACQTYKEW
GAKRLVCSSGGNAGIAVAYSGRLLGVPVTVVVPETTSAAARERIAAEGAELVVYGRAWSE
ANDHALSLMRPEYAFIHPFDDPLLWEGHATMIDEVAAAGVKPGAVVLSVGGGGLLCGVLA
GLERNGWHDVPVIAAETVGADSYAASLAAGAQVELPAITSIATSLGARSPCAKALEWSKV
HSIVSEVVTDKEAVGACLRFLAEHRIVVEPACGAALAALERKPAAVTAASDVLVIVCGGA
GATAEQLQAWDRGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory