SitesBLAST
Comparing RR42_RS33930 FitnessBrowser__Cup4G11:RR42_RS33930 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7c8zA Crystal structure of salicylate 5-hydroxylase naggh (a rieske non-heme iron-dependent monooxgenase) (see paper)
73% identity, 97% coverage: 12:416/418 of query aligns to 8:381/383 of 7c8zA
- active site: H106 (= H110), D213 (= D217), H216 (= H220), H221 (= H225), D330 (= D365)
- binding fe (iii) ion: H216 (= H220), H221 (= H225), D330 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), C103 (= C107), H106 (= H110), W108 (= W112)
7q05E Crystal structure of tpado in complex with tpa (see paper)
40% identity, 97% coverage: 12:416/418 of query aligns to 5:390/409 of 7q05E
- binding fe2/s2 (inorganic) cluster: C80 (= C87), H82 (= H89), R83 (= R90), C100 (= C107), Y102 (= Y109), H103 (= H110), W105 (= W112)
- binding terephthalic acid: V203 (≠ I215), A209 (≠ P221), S241 (≠ M253), L271 (≠ A297), I273 (≠ M299), R292 (= R318), D339 (= D365)
7q06D Crystal structure of tpado in complex with 2-oh-tpa (see paper)
39% identity, 97% coverage: 12:416/418 of query aligns to 5:385/389 of 7q06D
- binding 2-Hydroxyterephthalic acid: V203 (≠ I215), S206 (≠ P218), A209 (≠ P221), F216 (= F228), N222 (≠ W234), S241 (= S271), I268 (≠ M299), R287 (= R318)
- binding fe (iii) ion: H208 (= H220), H213 (= H225), D334 (= D365)
- binding fe2/s2 (inorganic) cluster: C80 (= C87), H82 (= H89), R83 (= R90), C100 (= C107), Y102 (= Y109), H103 (= H110), W105 (= W112)
7vjuA Crystal structure of terephthalate dioxygenase from comamonas testosteroni kf1 (see paper)
39% identity, 97% coverage: 12:416/418 of query aligns to 4:374/378 of 7vjuA
7q04D Crystal structure of tpado in a substrate-free state (see paper)
38% identity, 97% coverage: 12:416/418 of query aligns to 4:371/374 of 7q04D
3gzxA Crystal structure of the biphenyl dioxygenase in complex with biphenyl from comamonas testosteroni sp. Strain b-356 (see paper)
30% identity, 96% coverage: 15:416/418 of query aligns to 12:430/440 of 3gzxA
- active site: H106 (= H110), D213 (= D217), H216 (= H220), H222 (= H225), D369 (= D365)
- binding biphenyl: Q209 (≠ N214), F210 (vs. gap), H216 (= H220), G302 (≠ Q288), H304 (≠ M299), L314 (≠ Q309)
- binding fe (ii) ion: Q209 (≠ N214), H216 (= H220), H222 (= H225), D369 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
Q53122 Biphenyl 2,3-dioxygenase subunit alpha; Biphenyl dioxygenase system, oxygenase component subunit alpha; BDO, oxygenase component subunit alpha; Rieske dioxygenase; Terminal oxygenase component of biphenyl dioxygenase, large subunit; EC 1.14.12.18 from Rhodococcus jostii (strain RHA1) (see paper)
30% identity, 100% coverage: 3:418/418 of query aligns to 7:441/460 of Q53122
- C98 (= C87) binding
- H100 (= H89) binding
- C118 (= C107) binding
- H121 (= H110) binding
- 217:230 (vs. 214:225, 36% identical) binding
- H224 (= H220) binding
- H230 (= H225) binding
- D378 (= D365) binding
1uliC Biphenyl dioxygenase (bpha1a2) derived from rhodococcus sp. Strain rha1 (see paper)
31% identity, 97% coverage: 12:418/418 of query aligns to 8:413/425 of 1uliC
- active site: H105 (= H110), D205 (= D217), H208 (= H220), H214 (= H225), D350 (= D365)
- binding fe (ii) ion: H208 (= H220), H214 (= H225), D350 (= D365)
- binding fe2/s2 (inorganic) cluster: C82 (= C87), H84 (= H89), R85 (= R90), C102 (= C107), Y104 (= Y109), H105 (= H110), W107 (= W112)
1uljA Biphenyl dioxygenase (bpha1a2) in complex with the substrate (see paper)
31% identity, 97% coverage: 12:418/418 of query aligns to 8:415/425 of 1uljA
- active site: H105 (= H110), D205 (= D217), H208 (= H220), H214 (= H225), D352 (= D365)
- binding biphenyl: Q201 (≠ N214), F202 (vs. gap), D205 (= D217), M206 (≠ P218), H208 (= H220), A209 (≠ P221), H214 (= H225), I252 (≠ A252), H287 (≠ M299), L297 (≠ Q309), F342 (= F355)
- binding fe (ii) ion: Q201 (≠ N214), H208 (= H220), H214 (= H225), D352 (= D365)
- binding fe2/s2 (inorganic) cluster: C82 (= C87), H84 (= H89), R85 (= R90), M87 (≠ V92), C102 (= C107), Y104 (= Y109), H105 (= H110), W107 (= W112)
5aeuA Crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 (see paper)
30% identity, 94% coverage: 26:416/418 of query aligns to 23:423/433 of 5aeuA
- active site: H106 (= H110), D204 (= D217), H207 (= H220), H213 (= H225), D362 (= D365)
- binding fe (ii) ion: H207 (= H220), H213 (= H225), D362 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), M88 (≠ V92), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
2yflA Crystal structure of biphenyl dioxygenase variant rr41 with 2-chloro dibenzofuran (see paper)
30% identity, 94% coverage: 26:416/418 of query aligns to 23:423/433 of 2yflA
- active site: H106 (= H110), D204 (= D217), H207 (= H220), H213 (= H225), D362 (= D365)
- binding 2-chlorodibenzofuran: Q200 (≠ N214), D204 (= D217), M205 (≠ P218), H207 (= H220), S257 (≠ A252), H297 (vs. gap), L307 (≠ Q309), F352 (= F355)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220), H213 (= H225), D362 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
2yfjA Crystal structure of biphenyl dioxygenase variant rr41 with dibenzofuran (see paper)
30% identity, 94% coverage: 26:416/418 of query aligns to 23:423/433 of 2yfjA
- active site: H106 (= H110), D204 (= D217), H207 (= H220), H213 (= H225), D362 (= D365)
- binding dibenzofuran: Q200 (≠ N214), F201 (vs. gap), D204 (= D217), M205 (≠ P218), H207 (= H220), A208 (≠ P221), H297 (vs. gap), L307 (≠ Q309), F358 (≠ V361)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220), H213 (= H225), D362 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
2xshA Crystal structure of p4 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with 2,6 di chlorobiphenyl (see paper)
30% identity, 94% coverage: 26:416/418 of query aligns to 23:423/433 of 2xshA
- active site: H106 (= H110), D204 (= D217), H207 (= H220), H213 (= H225), D362 (= D365)
- binding 2,6-dichlorobiphenyl: F201 (vs. gap), M205 (≠ P218), H207 (= H220), Q296 (vs. gap), H297 (vs. gap), L307 (≠ Q309), F358 (≠ V361)
- binding fe (ii) ion: Q200 (≠ N214), H207 (= H220), H213 (= H225), D362 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
1wqlA Cumene dioxygenase (cuma1a2) from pseudomonas fluorescens ip01 (see paper)
31% identity, 94% coverage: 26:416/418 of query aligns to 23:426/436 of 1wqlA
- active site: H106 (= H110), D208 (= D217), H211 (= H220), H217 (= H225), D365 (= D365)
- binding fe (ii) ion: H211 (= H220), H217 (= H225), D365 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
- binding oxygen molecule: H211 (= H220), F355 (= F355)
2xrxA Crystal structure of biphenyl dioxygenase in complex with biphenyl from burkholderia xenovorans lb400 (see paper)
29% identity, 94% coverage: 26:416/418 of query aligns to 23:422/432 of 2xrxA
- active site: H106 (= H110), D203 (= D217), H206 (= H220), H212 (= H225), D361 (= D365)
- binding biphenyl: Q199 (≠ N214), F200 (vs. gap), D203 (= D217), H206 (= H220), H296 (vs. gap), L306 (≠ Q309), F309 (≠ V312), F357 (≠ V361)
- binding fe (ii) ion: Q199 (≠ N214), H206 (= H220), H212 (= H225), D361 (= D365)
- binding fe2/s2 (inorganic) cluster: C83 (= C87), H85 (= H89), R86 (= R90), C103 (= C107), Y105 (= Y109), H106 (= H110), W108 (= W112)
3en1A Crystal structure of toluene 2,3-dioxygenase (see paper)
30% identity, 97% coverage: 15:418/418 of query aligns to 11:424/424 of 3en1A
- active site: H105 (= H110), D205 (= D217), H208 (= H220), H214 (= H225), D360 (= D365)
- binding fe (ii) ion: Q201 (≠ N214), H208 (= H220), H214 (= H225), D360 (= D365)
- binding fe2/s2 (inorganic) cluster: C82 (= C87), H84 (= H89), R85 (= R90), C102 (= C107), Y104 (= Y109), H105 (= H110), W107 (= W112)
- binding toluene: Q201 (≠ N214), F202 (vs. gap), D205 (= D217), H208 (= H220), H295 (≠ M299)
O85673 Anthranilate 1,2-dioxygenase large subunit; EC 1.14.12.1 from Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) (see 2 papers)
29% identity, 87% coverage: 15:377/418 of query aligns to 22:391/471 of O85673
- M43 (≠ L36) mutation to K: Prevents anthranilate degradation.
- D217 (= D217) mutation to A: In ACN476; loss of dioxygenase activity and 2-fold lower redox potential.; mutation to E: Loss of dioxygenase activity and lack of iron at the mononuclear site.; mutation to N: Loss of dioxygenase activity.
2gbxA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 bound to biphenyl (see paper)
28% identity, 96% coverage: 19:418/418 of query aligns to 11:418/449 of 2gbxA
- active site: H98 (= H110), D199 (= D217), H202 (= H220), H207 (= H225), D355 (= D365)
- binding biphenyl: D199 (= D217), V203 (≠ P221), L255 (≠ K262), H288 (≠ A297), N290 (≠ M299), L300 (≠ Q309)
- binding fe (iii) ion: H202 (= H220), H207 (= H225), D355 (= D365)
- binding fe2/s2 (inorganic) cluster: C75 (= C87), H77 (= H89), R78 (= R90), C95 (= C107), Y97 (= Y109), H98 (= H110), W100 (= W112)
2gbwA Crystal structure of biphenyl 2,3-dioxygenase from sphingomonas yanoikuyae b1 (see paper)
28% identity, 96% coverage: 19:418/418 of query aligns to 11:418/449 of 2gbwA
- active site: H98 (= H110), D199 (= D217), H202 (= H220), H207 (= H225), D355 (= D365)
- binding fe (iii) ion: H202 (= H220), H207 (= H225), D355 (= D365)
- binding fe2/s2 (inorganic) cluster: C75 (= C87), H77 (= H89), R78 (= R90), C95 (= C107), Y97 (= Y109), H98 (= H110), W100 (= W112)
- binding oxygen molecule: H202 (= H220), F345 (= F355), D355 (= D365)
2b1xA Crystal structure of naphthalene 1,2-dioxygenase from rhodococcus sp. (see paper)
37% identity, 53% coverage: 21:242/418 of query aligns to 23:238/441 of 2b1xA
- active site: H111 (= H110), D213 (= D217), H216 (= H220), H221 (= H225)
- binding fe (iii) ion: H216 (= H220), H221 (= H225)
- binding fe2/s2 (inorganic) cluster: C88 (= C87), H90 (= H89), R91 (= R90), C108 (= C107), Y110 (= Y109), H111 (= H110), W113 (= W112)
Sites not aligning to the query:
Query Sequence
>RR42_RS33930 FitnessBrowser__Cup4G11:RR42_RS33930
MREQAVVFKKKEWQDEGSSRIPFWAYTDDDVYRQELERFFYAGHWCYIGLEAEIPNAGDF
KRTAIGERSVIASRAADGEIYVVENVCAHRGVQFCRERSGNRKDFTCPYHQWNYDLKGNL
VGVPFRRGVKLDGKVNGGMPADFDPKAHGLTKLKVARRNGVIFASFDHEVPTLEDYLGPT
ILAYFDRVFDGRKLTILGYNRQQIPGNWKLMQENIKDPYHPGLLHTWFVTFGLWRADNKS
ALKMDEHFRHAAMISTRGQGGKGDVTSGVSSFKEQMRLHDDRFLDVAQEPWWGEPTAVMM
TLFPSVIIQQQVNSVSTRHIQPTGHGSFNFVWTHFGFEGDDADMTRRRLRQANLFGPAGF
VSADDGEVIEFSQQGFEQKPFHRTVAELGGREIGDTDHMVTETLIRGMYNYWRRVMEA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory