SitesBLAST
Comparing RR42_RS33945 FitnessBrowser__Cup4G11:RR42_RS33945 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
P0AA76 D-galactonate transporter; D-galactonate/H(+) symporter from Escherichia coli (strain K12) (see paper)
25% identity, 93% coverage: 16:430/446 of query aligns to 2:417/430 of P0AA76
- Y29 (= Y48) binding
- D31 (= D50) mutation to N: Loss of galactonate transport activity.
- R32 (= R51) binding
- Y64 (= Y83) binding
- E118 (= E137) mutation to Q: Loss of galactonate transport activity.
- W358 (= W371) binding
6e9nA E. Coli d-galactonate:proton symporter in the inward open form (see paper)
23% identity, 86% coverage: 45:427/446 of query aligns to 15:395/409 of 6e9nA
P53322 High-affinity nicotinic acid transporter; Nicotinic acid permease from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
22% identity, 94% coverage: 18:435/446 of query aligns to 74:491/534 of P53322
- K283 (≠ A229) modified: Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)
6e9oA E. Coli d-galactonate:proton symporter mutant e133q in the outward substrate-bound form (see paper)
23% identity, 86% coverage: 45:427/446 of query aligns to 18:379/393 of 6e9oA
Q9C0U9 Uncharacterized transporter PB1C11.03 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
22% identity, 78% coverage: 23:372/446 of query aligns to 89:443/570 of Q9C0U9
Sites not aligning to the query:
- 14 modified: Phosphoserine
Q5EXK5 3-hydroxybenzoate transporter MhbT from Klebsiella oxytoca (see paper)
24% identity, 78% coverage: 95:444/446 of query aligns to 82:442/452 of Q5EXK5
- D82 (≠ E95) mutation to A: Loss of activity.
- V311 (≠ R317) mutation to W: Loss of activity.
- D314 (= D320) mutation to A: Loss of activity.
Q9JI12 Vesicular glutamate transporter 2; VGluT2; Differentiation-associated BNPI; Differentiation-associated Na(+)-dependent inorganic phosphate cotransporter; Solute carrier family 17 member 6 from Rattus norvegicus (Rat) (see 2 papers)
25% identity, 59% coverage: 46:306/446 of query aligns to 93:357/582 of Q9JI12
- H128 (≠ A76) mutation to A: Greatly lowers L-glutamate transport.
- R184 (= R130) mutation R->A,E,K: Greatly lowers L-glutamate transport.
- E191 (= E137) mutation to A: Greatly lowers L-glutamate transport.; mutation E->D,Q: Lowers L-glutamate transport.
- R322 (≠ L274) mutation to A: Loss of L-glutamate release. Abolishes the chloride ion conductance.
Sites not aligning to the query:
- 88 R→A: Impairs synaptic transmission. Abolishes the chloride ion conductance.
7t3nA R184q/e191q mutant of rat vesicular glutamate transporter 2 (vglut2)
24% identity, 59% coverage: 46:306/446 of query aligns to 35:299/452 of 7t3nA
Sites not aligning to the query:
Q8BN82 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Mus musculus (Mouse) (see paper)
22% identity, 55% coverage: 77:320/446 of query aligns to 113:350/495 of Q8BN82
- H183 (≠ L145) mutation to R: Abolishes sialic acid transporter activity. Does not affect L-aspartate and L-glutamate transporter activity.
Sites not aligning to the query:
- 39 R→C: Completely abolishes L-aspartate and L-glutamate transporter activity. Retains appreciable H(+)-coupled sialic acid transporter activity.
Q9NRA2 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Membrane glycoprotein HP59; Solute carrier family 17 member 5; Vesicular excitatory amino acid transporter; VEAT from Homo sapiens (Human) (see 8 papers)
20% identity, 82% coverage: 77:442/446 of query aligns to 113:484/495 of Q9NRA2
- K136 (≠ R100) to E: in SD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transporter activity, but retains appreciable H(+)-coupled sialic acid transporter activity; dbSNP:rs80338795
- H183 (≠ L145) to R: in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity; dbSNP:rs119491109
- LL 198:199 (≠ II 160:161) mutation to AA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- I---L 266:267 (≠ IEREL 234:238) mutation to LA: Localizes in vesicular structures mainly concentrated in the perinuclear region.
- SSLRN 268:272 (≠ AADQS 239:243) natural variant: Missing (in ISSD; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; abolishes H(+)-coupled sialic acid transporter activity; has normal L-aspartate and L-glutamate transporter activity)
- G328 (= G298) to E: in ISSD; some patients may manifest a milder phenotype consistent with Salla disease; markedly decreases H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs386833996
- P334 (= P304) to R: in ISSD; does not affect intracellular localization, targeted to lysosomes; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs119491110
- G371 (= G336) to V: in ISSD; abolishes H(+)-coupled sialic acid transporter activity; abolishes L-aspartate and L-glutamate transporter activity; dbSNP:rs777862172
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane.; LL→GG: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R → C: in SD; frequent variant in Finland; alters intracellular localization, only partially targeted to lysosomes and mainly detected in LAMP1-negative vesicles and in the Golgi apparatus; completely devoid of L-aspartate and L-glutamate transport activity, but retains appreciable H(+)-coupled sialic acid and nitrate transporter activity; dbSNP:rs80338794
Q5Q0U0 Sialin; H(+)/nitrate cotransporter; H(+)/sialic acid cotransporter; AST; Solute carrier family 17 (Anion/sugar transporter), member 5; Vesicular excitatory amino acid transporter; VEAT from Rattus norvegicus (Rat) (see 2 papers)
21% identity, 52% coverage: 77:306/446 of query aligns to 113:336/495 of Q5Q0U0
- K136 (≠ R100) mutation to E: Markedly decreases H(+)-coupled sialic acid transporter activity.
- R168 (= R130) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- E171 (≠ L133) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-175.
- G172 (= G134) mutation to C: Decreases protein levels and alters subcellular localization.
- E175 (= E137) mutation to C: Decreases H(+)-coupled sialic acid transporter activity; when associated with C-171.
- G176 (≠ A138) mutation to C: Decreases protein levels and alters subcellular localization.
- F179 (≠ Y141) mutation to C: Decreases the affinity and transport rate for D-glucuronate. Does not affect H(+)-coupled sialic acid transporter activity.
- P180 (= P142) mutation to C: Decreases protein levels and alters subcellular localization.
- H183 (≠ L145) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
- W186 (≠ L148) mutation to C: Abolishes H(+)-coupled sialic acid transporter activity.
- SSLKN 268:272 (≠ RELAA 236:240) mutation Missing: Abolishes H(+)-coupled sialic acid transporter activity.
- P334 (= P304) mutation to R: Abolishes H(+)-coupled sialic acid transporter activity.
Sites not aligning to the query:
- 22:23 Dileucine internalization motif; LL→AA: Targeted to plasma membrane; sialic acid uptake strongly activated at acidic pH.
- 39 R→C: Markedly decreases H(+)-coupled sialic acid transporter activity.
- 371 G→V: Remains in the endoplasmic reticulum.
Query Sequence
>RR42_RS33945 FitnessBrowser__Cup4G11:RR42_RS33945
MDRPVPLPGAADLPGDTPAGAASEESRIISMLTRKLIPFLALIYVVAYIDRSVVGFAKLH
MNAAVGISDASYGLGAGLFFIGYFLCEVPSNLALERFGARRWFARILFTWGVITMAMALI
NSASTFYVLRFLLGAAEAGLYPGILYFLTKWFPMRHRARIIGLLVLAQPIALIVTGPIAG
WVLSTSGLFGLTNWQTLFVLSGLPAVLLCLPTLRILPESPSQARWLAPADRAWIERELAA
DQSTFALKAHGNPLGALKDKRVLLLALLFLPFPLSIYGLSLWLPTIIKQFGVTDATTGLL
SAVPYLFAVVGLYLVPRHSDRKGERYWHIIVVSAMGAITMAASAWVQTPALQFLFICLTA
FSIYSIQAVVWALPGQFLTGASAAVGIATINSLANLGGYLGPYGIGLIKDATGKLASGLY
FLAAMLVFAVLMTFVVRSALETPARS
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory