Comparing RR42_RS34310 FitnessBrowser__Cup4G11:RR42_RS34310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ymwC Crystal structure of an amino acid abc transporter with histidines (see paper)
43% identity, 97% coverage: 1:215/222 of query aligns to 1:214/214 of 4ymwC
4ymtC Crystal structure of an amino acid abc transporter complex with arginines (see paper)
43% identity, 97% coverage: 1:215/222 of query aligns to 1:214/215 of 4ymtC
>RR42_RS34310 FitnessBrowser__Cup4G11:RR42_RS34310
MDANFFQHAREFLPILLQGAVVTVEVTVLAFVLSSLLGLALALMKLSPARTLSWGASGAI
NVIRGLPIIVQLFYIYFVLPDAGIHLTAFQAGVIGLGIAYSAYQAENFRAGIEAVDPGQR
EAAQAMGMRPALVMRRVILPQALRISLPPYGNTLVMMLKDSSLVSTITVAEMTRAGQLIA
SSTFQNMTVYTLVALLYLLMSLPLVFGLRRLERRLGVGRKKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory