Comparing RR42_RS34315 FitnessBrowser__Cup4G11:RR42_RS34315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
35% identity, 87% coverage: 31:252/254 of query aligns to 5:222/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
35% identity, 87% coverage: 31:252/254 of query aligns to 5:224/226 of 4zv1A
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
30% identity, 87% coverage: 31:252/254 of query aligns to 11:227/229 of 5t0wA
4kqpA Crystal structure of lactococcus lactis glnp substrate binding domain 2 (sbd2) in complex with glutamine at 0.95 a resolution (see paper)
30% identity, 87% coverage: 32:252/254 of query aligns to 8:225/230 of 4kqpA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
31% identity, 87% coverage: 33:252/254 of query aligns to 20:233/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
31% identity, 87% coverage: 33:252/254 of query aligns to 20:233/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
31% identity, 87% coverage: 33:252/254 of query aligns to 20:233/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
31% identity, 87% coverage: 33:252/254 of query aligns to 16:229/237 of 3vv5A
2y7iA Structural basis for high arginine specificity in salmonella typhimurium periplasmic binding protein stm4351. (see paper)
32% identity, 89% coverage: 28:252/254 of query aligns to 4:226/228 of 2y7iA
3tqlA Structure of the amino acid abc transporter, periplasmic amino acid- binding protein from coxiella burnetii. (see paper)
36% identity, 85% coverage: 38:252/254 of query aligns to 10:224/225 of 3tqlA
Sites not aligning to the query:
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
31% identity, 86% coverage: 34:252/254 of query aligns to 14:226/229 of 6svfA
4g4pA Crystal structure of glutamine-binding protein from enterococcus faecalis at 1.5 a (see paper)
29% identity, 90% coverage: 24:252/254 of query aligns to 7:233/235 of 4g4pA
8b5dA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
27% identity, 87% coverage: 31:252/254 of query aligns to 1:219/223 of 8b5dA
4ymxA Crystal structure of the substrate binding protein of an amino acid abc transporter (see paper)
27% identity, 86% coverage: 34:252/254 of query aligns to 5:221/224 of 4ymxA
4zefA Crystal structure of substrate binding domain 2 (sbd2) of abc transporter glnpq from enterococcus faecalis
29% identity, 87% coverage: 32:252/254 of query aligns to 18:235/239 of 4zefA
8b5eA Exploring the ligand binding and conformational dynamics of receptor domain 1 of the abc transporter glnpq
27% identity, 87% coverage: 31:252/254 of query aligns to 3:221/225 of 8b5eA
6fxgB Crystal structure of substrate binding domain 1 (sbd1) of abc transporter glnpq in complex with asparagine
27% identity, 87% coverage: 31:252/254 of query aligns to 4:222/226 of 6fxgB
P0AEU0 Histidine-binding periplasmic protein; HBP from Escherichia coli (strain K12) (see 3 papers)
32% identity, 86% coverage: 34:252/254 of query aligns to 30:252/260 of P0AEU0
Sites not aligning to the query:
5orgA Structure of the periplasmic binding protein (pbp) occj from a. Tumefaciens b6 in complex with octopine. (see paper)
30% identity, 79% coverage: 53:252/254 of query aligns to 26:249/257 of 5orgA
Sites not aligning to the query:
5owfA Structure of a lao-binding protein mutant with glutamine (see paper)
32% identity, 87% coverage: 31:252/254 of query aligns to 2:227/235 of 5owfA
>RR42_RS34315 FitnessBrowser__Cup4G11:RR42_RS34315
MSRFTMSRRAALILCAASTVSFAWAQGAAPTYNVGATATGVPFTFLDVKTNTIQGMMVDT
VTAVGKAGGFNVNVQQTVFSALIPSLTSSKIDIISAAMLKTPARQQVVDFSDPVYAYGEG
LIVKGDDNKPYASLDELKGEVVGAQVGTVFLDMLNKKGIFKEVRSYDSVADMTRDLTLGR
IKAGLGDQPIIAYQIRQNAFPGVKLAASYKPVNVGDVCLVVRKGDTETLARINKAIAKIK
ADGTLAGIIQKWNM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory