Comparing RR42_RS34560 FitnessBrowser__Cup4G11:RR42_RS34560 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5i1fA Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia vietnamiensis in complex with uridine-5'-diphosphate- glucose
82% identity, 98% coverage: 1:284/291 of query aligns to 2:285/290 of 5i1fA
5ve7A Crystal structure of utp-glucose-1-phosphate uridylyltransferase from burkholderia ambifaria in complex with utp
80% identity, 98% coverage: 2:286/291 of query aligns to 1:281/282 of 5ve7A
2ux8G Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
52% identity, 94% coverage: 4:276/291 of query aligns to 5:275/288 of 2ux8G
8f73E Crystal structure of pseudomonas aeruginosa udp-glucose phosphorylase in complex with udp-glucose
51% identity, 90% coverage: 4:266/291 of query aligns to 8:271/281 of 8f73E
3jukD The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
49% identity, 90% coverage: 4:266/291 of query aligns to 2:257/264 of 3jukD
3jukA The crystal structure of udp-glucose pyrophosphorylase complexed with udp-glucose (see paper)
49% identity, 90% coverage: 4:266/291 of query aligns to 2:257/265 of 3jukA
6knlA Uridine and triphosphate-bound ugpase from acinetobacter baumannii
47% identity, 97% coverage: 4:284/291 of query aligns to 2:286/290 of 6knlA
6k8dA Udp-glucose pyrophosphorylase with upg from acinetobacter baumanii
47% identity, 97% coverage: 4:284/291 of query aligns to 2:286/290 of 6k8dA
6ikzB Udp-glucose pyrophosphorylase from acinetobacter baumanii
46% identity, 97% coverage: 4:284/291 of query aligns to 2:281/285 of 6ikzB
2ux8A Crystal structure of sphingomonas elodea atcc 31461 glucose-1- phosphate uridylyltransferase in complex with glucose-1-phosphate. (see paper)
46% identity, 94% coverage: 4:276/291 of query aligns to 5:242/255 of 2ux8A
2pa4B Crystal structure of udp-glucose pyrophosphorylase from corynebacteria glutamicum in complex with magnesium and udp-glucose (see paper)
41% identity, 93% coverage: 4:273/291 of query aligns to 3:275/299 of 2pa4B
8b6dA Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp
40% identity, 97% coverage: 7:289/291 of query aligns to 5:289/291 of 8b6dA
8b68A Crystal structure of udp-glucose pyrophosphorylase from thermocrispum agreste dsm 44070 in complex with udp-glucose
39% identity, 97% coverage: 7:289/291 of query aligns to 5:284/286 of 8b68A
5ifyA Crystal structure of glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis in complex with 2 -deoxyuridine-5'- monophosphate and 2'-deoxy-thymidine-b-l-rhamnose
30% identity, 82% coverage: 5:243/291 of query aligns to 2:210/293 of 5ifyA
Sites not aligning to the query:
P26393 Glucose-1-phosphate thymidylyltransferase; dTDP-glucose pyrophosphorylase; Ep; dTDP-glucose synthase; EC 2.7.7.24 from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
28% identity, 91% coverage: 2:266/291 of query aligns to 1:237/292 of P26393
3pkpA Q83s variant of s. Enterica rmla with datp (see paper)
28% identity, 91% coverage: 2:266/291 of query aligns to 1:237/290 of 3pkpA
3pkpB Q83s variant of s. Enterica rmla with datp (see paper)
28% identity, 91% coverage: 3:266/291 of query aligns to 1:236/289 of 3pkpB
1iinA Thymidylyltransferase complexed with udp-glucose (see paper)
28% identity, 91% coverage: 2:266/291 of query aligns to 1:237/289 of 1iinA
1iimA Thymidylyltransferase complexed with ttp (see paper)
28% identity, 91% coverage: 2:266/291 of query aligns to 1:237/289 of 1iimA
Sites not aligning to the query:
6n0uA Crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia phymatum bound to 2'-deoxy-thymidine-b-l-rhamnose
27% identity, 82% coverage: 5:242/291 of query aligns to 4:211/295 of 6n0uA
>RR42_RS34560 FitnessBrowser__Cup4G11:RR42_RS34560
MLKIRKAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAMAAGITELIFVTGRS
KRAIEDHFDKSYEVEAELLARGKQQLLDLVRSIKPAHVDCFYVRQAEPLGLGHAVRCASK
LIGDEPFAVILADDLLDARTPVLKQMIEVFDHYHSCVIGVEEIQPQDSRAYGVIDGKPWD
DRIFKMSGIVEKPAPEVAPSNLGVVGRYVLMPSIFELLNALKPGAGGELQLTDAIQALLA
REQALAYRYEGRRFDCGSKLGYLKATVEFALRHAEVSAPFAQYLRTECAIV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory