SitesBLAST
Comparing RR42_RS34595 FitnessBrowser__Cup4G11:RR42_RS34595 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
36% identity, 34% coverage: 346:587/704 of query aligns to 154:397/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ F382), R206 (= R398), Q207 (≠ T399), Y208 (= Y400), S209 (≠ T401), S222 (= S414), E226 (= E418), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (≠ T420), V236 (= V421), S237 (= S422), V395 (≠ A585), G397 (= G587)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
36% identity, 34% coverage: 346:587/704 of query aligns to 154:397/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R398), Q207 (≠ T399), Y208 (= Y400), S209 (≠ T401), S222 (= S414), V223 (= V415), K224 (= K416), E226 (= E418), P232 (vs. gap), G234 (vs. gap), Y235 (≠ T420), V236 (= V421), S237 (= S422), V276 (≠ I461), T279 (= T464), V395 (≠ A585), F396 (= F586)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
36% identity, 34% coverage: 346:587/704 of query aligns to 154:397/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R398), Q207 (≠ T399), Y208 (= Y400), S209 (≠ T401), S222 (= S414), V223 (= V415), K224 (= K416), E226 (= E418), P232 (vs. gap), G234 (vs. gap), Y235 (≠ T420), V236 (= V421), S237 (= S422), V276 (≠ I461), T279 (= T464), F396 (= F586)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
36% identity, 34% coverage: 346:587/704 of query aligns to 154:397/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R398), Q207 (≠ T399), Y208 (= Y400), S209 (≠ T401), S222 (= S414), V223 (= V415), K224 (= K416), E226 (= E418), P232 (vs. gap), G234 (vs. gap), Y235 (≠ T420), V236 (= V421), S237 (= S422), E394 (= E584), V395 (≠ A585), G397 (= G587)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
36% identity, 34% coverage: 346:587/704 of query aligns to 154:397/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
36% identity, 34% coverage: 347:587/704 of query aligns to 4:236/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ F382), R55 (= R398), Q56 (≠ T399), Y57 (= Y400), S58 (≠ T401), S71 (= S414), V72 (= V415), E75 (= E418), N81 (vs. gap), G83 (vs. gap), L84 (vs. gap), V85 (= V421), S86 (= S422), T127 (= T464), E233 (= E584), F235 (= F586)
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
34% identity, 37% coverage: 332:592/704 of query aligns to 135:396/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ F382), R204 (= R398), Q205 (≠ T399), Y206 (= Y400), S207 (≠ T401), A220 (≠ S414), V221 (= V415), E224 (= E418), G227 (= G419), Q228 (≠ T420), V229 (= V421), S230 (= S422), V269 (≠ I461), T272 (= T464), E388 (= E584), F390 (= F586)
- binding protoporphyrin ix containing fe: H393 (≠ S589)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
34% identity, 37% coverage: 332:592/704 of query aligns to 135:396/396 of P24232
- E135 (= E332) active site, Charge relay system
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
27% identity, 35% coverage: 346:589/704 of query aligns to 160:386/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
27% identity, 38% coverage: 318:587/704 of query aligns to 112:391/398 of 4g1bA
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: Y126 (vs. gap)
- binding flavin-adenine dinucleotide: Y189 (≠ F382), R207 (= R398), H208 (≠ T399), Y209 (= Y400), S210 (≠ T401), A223 (≠ S414), K225 (= K416), E227 (= E418), F233 (vs. gap), P234 (vs. gap), G236 (= G419), L237 (≠ T420), V238 (= V421), S239 (= S422), V282 (≠ I461), F390 (= F586)
- binding protoporphyrin ix containing fe: F133 (vs. gap)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 28, 29, 56, 57, 60, 102
- binding flavin-adenine dinucleotide: 46, 50, 84
- binding protoporphyrin ix containing fe: 42, 43, 44, 47, 60, 80, 81, 84, 85, 88, 90, 94, 95, 98, 392, 393, 394
7ylrA Structure of a bacteria protein
27% identity, 48% coverage: 349:683/704 of query aligns to 8:314/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C647), K277 (≠ R648), G279 (= G650), C281 (= C652), G282 (= G653), C284 (= C655), C314 (= C683)
- binding flavin mononucleotide: R56 (= R398), H57 (≠ T399), Y58 (= Y400), S59 (≠ T401), A79 (≠ S414), V80 (= V415), R81 (≠ K416), G86 (≠ V421), R87 (vs. gap), G89 (vs. gap), S90 (= S422), T131 (= T464), E229 (= E584), F231 (= F586), E233 (≠ A602), R278 (≠ G649)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
26% identity, 46% coverage: 361:683/704 of query aligns to 24:309/322 of P33164
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
26% identity, 46% coverage: 361:683/704 of query aligns to 23:308/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ F645), C272 (= C647), E273 (≠ R648), G275 (= G650), C277 (= C652), G278 (= G653), C280 (= C655), C308 (= C683)
- binding flavin mononucleotide: N44 (≠ F382), R55 (= R398), T56 (= T399), Y57 (= Y400), S58 (≠ T401), A72 (≠ S414), V73 (= V415), G79 (vs. gap), R80 (vs. gap), G82 (= G419), S83 (≠ T420), I121 (= I461), T124 (= T464), E223 (= E584), F225 (= F586)
6o0aA Crystal structure of flavohemoglobin from malassezia yamatoensis with bound fad and heme determined by iron sad phasing (see paper)
30% identity, 34% coverage: 349:587/704 of query aligns to 157:383/383 of 6o0aA
- binding flavin-adenine dinucleotide: Y190 (≠ F382), R205 (= R398), Q206 (≠ T399), F207 (≠ Y400), T208 (= T401), K222 (= K416), D224 (≠ E418), H226 (vs. gap), G227 (= G419), E228 (≠ T420), M229 (≠ V421), T230 (≠ S422), T274 (= T464), E380 (= E584), F382 (= F586), G383 (= G587)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 48, 51, 52
- binding protoporphyrin ix containing fe: 44, 45, 46, 59, 62, 84, 85, 89, 92, 94, 98, 99, 102, 130, 133
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
24% identity, 34% coverage: 351:589/704 of query aligns to 112:337/337 of 1krhA
- active site: C306 (= C558)
- binding flavin-adenine dinucleotide: Y143 (≠ F382), R155 (= R398), S156 (≠ T399), Y157 (= Y400), S158 (≠ T401), V171 (≠ S414), V172 (= V415), G178 (= G419), K179 (≠ T420), M180 (≠ V421), S181 (= S422), T219 (≠ I461), E332 (= E584), F334 (= F586), S335 (≠ G587), A336 (= A588), N337 (≠ S589)
Sites not aligning to the query:
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
25% identity, 42% coverage: 398:690/704 of query aligns to 487:747/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ F645), C702 (= C647), E703 (≠ R648), G705 (= G650), C707 (= C652), G708 (= G653), C710 (= C655), C740 (= C683)
- binding flavin mononucleotide: R487 (= R398), Q488 (≠ T399), Y489 (= Y400), S490 (≠ T401), Q506 (≠ K416), S511 (≠ V421), R512 (vs. gap), G514 (vs. gap), S515 (= S422), I553 (= I461), E651 (≠ K594), F653 (≠ D596)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
24% identity, 42% coverage: 396:690/704 of query aligns to 497:759/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C647), E715 (≠ R648), G717 (= G650), C719 (= C652), G720 (= G653), C722 (= C655), C752 (= C683)
- binding flavin mononucleotide: R499 (= R398), Q500 (≠ T399), Y501 (= Y400), S502 (≠ T401), A516 (≠ S414), L518 (≠ K416), S523 (≠ V421), R524 (vs. gap), G526 (vs. gap), S527 (= S422), I565 (= I461), T568 (= T464), E663 (= E584), F665 (= F586), I718 (≠ S651)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
Q68EJ0 Cytochrome b5 reductase 4; Flavohemoprotein b5/b5R; b5+b5R; N-terminal cytochrome b5 and cytochrome b5 oxidoreductase domain-containing protein; cb5/cb5R; EC 1.6.2.2 from Rattus norvegicus (Rat) (see paper)
29% identity, 25% coverage: 404:582/704 of query aligns to 341:516/520 of Q68EJ0
Sites not aligning to the query:
- 89 mutation H->A,M: Abolishes heme-binding but does not affect reductase activity.
- 112 mutation H->A,M: Abolishes heme-binding but does not affect reductase activity.
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
26% identity, 31% coverage: 375:590/704 of query aligns to 125:333/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F382), R144 (= R398), Q145 (≠ T399), Y146 (= Y400), S147 (≠ T401), H161 (≠ S414), V162 (= V415), V165 (vs. gap), G168 (≠ T420), V169 (= V421), A170 (≠ S422), T171 (≠ R423), T214 (≠ I461), F329 (= F586), P331 (≠ A588), S333 (= S590)
Sites not aligning to the query:
Q9ZNT1 NADH--cytochrome b5 reductase 1; EC 1.6.2.2 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
23% identity, 34% coverage: 333:574/704 of query aligns to 34:271/281 of Q9ZNT1
- 34:40 (vs. 333:339, 14% identical) AKR2A-binding sequence (ABS) required for mitochondrion outer membrane targeting
- L78 (≠ H377) mutation to F: In cbr1-1; decreased stability and decreased activity.
Query Sequence
>RR42_RS34595 FitnessBrowser__Cup4G11:RR42_RS34595
MSTQAQPSTQATHAPAQPWHAGERSLQARAGVAGRMEDVGRRVVRDYMPDQHREFFAQLP
MVVLGAVAPDGRVWATLRAGQPGFLHSPDATTLNIAMASEPADPADAGMEDGSAIGLLGI
DLLTRRRNRMNGTARRGDGDGVLRIDVEQSFGNCPQYIQKRVFEFARTPGTPGARSPAAA
HLTALDARARALIGSADTFFVASYVDLEEGGRQVDVSHRGGKPGFVRIDAHGGLTIPDFA
GNLFFNTLGNFVVNPIAGLVFADFSTGELLQLSGKAEVILDSPEIAAFQGAERLWRFQPE
QIVRRDEALPLRWQPQADGASPNSLMTGSWDEAGSRQRAAALANAWRPFRVARIVDESSV
IRSFHLEPADGAGRVAHLAGQFLPIRVTLAGQAQPVMRTYTLSVSPADDVYRISVKREGT
VSRHLHDNVRVGDLIEARAPTGAFTIDAAERRPAVLLAAGIGVTPMLAMLRHIVYEGLRK
RRVRPAWFFHSARTVAERAFSKELATLTESAGGAVELVRLLSDPKDATRVKDYDVSGRID
IGLLRARLPLDDYDFYLCGPTAFMQSLYDGLRALNIADSRIHAEAFGASSLVRKHDAGHP
AAPTARPAPQPVPVTFVQSAKEARWTPGGGSLLELAEQRGLAPAFGCRGGSCGSCSTRVL
QGSVAYAEAPEFDVAQGEALICCAVPAAVDADGNDAVVPLQLDL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory