Comparing RR42_RS34600 FitnessBrowser__Cup4G11:RR42_RS34600 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 13 hits to proteins with known functional sites (download)
3b59A Crystal structure of the mn(ii)-bound glyoxalase from novosphingobium aromaticivorans
30% identity, 70% coverage: 80:298/312 of query aligns to 75:276/301 of 3b59A
6l3wA Crystal structure of bphc, a halotolerant catechol dioxygenase (see paper)
25% identity, 78% coverage: 63:306/312 of query aligns to 56:295/298 of 6l3wA
3hpvA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas sp. Kl28 (see paper)
26% identity, 44% coverage: 154:290/312 of query aligns to 146:280/297 of 3hpvA
3hq0B Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in complex with a product (see paper)
26% identity, 44% coverage: 154:290/312 of query aligns to 146:280/288 of 3hq0B
3hpyA Crystal structure analysis of the 2,3-dioxygenase lapb from pseudomonas in the complex with 4-methylcatechol (see paper)
26% identity, 44% coverage: 154:290/312 of query aligns to 146:280/288 of 3hpyA
2zi8A Crystal structure of the hsac extradiol dioxygenase from m. Tuberculosis in complex with 3,4-dihydroxy-9,10-seconandrost-1,3, 5(10)-triene-9,17-dione (dhsa) (see paper)
25% identity, 68% coverage: 63:273/312 of query aligns to 55:270/299 of 2zi8A
Sites not aligning to the query:
P9WNW7 Iron-dependent extradiol dioxygenase; EC 1.13.11.25 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
25% identity, 68% coverage: 63:273/312 of query aligns to 55:270/300 of P9WNW7
1lkdA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2',6'-dicl dihydroxybiphenyl (dhb) (see paper)
32% identity, 36% coverage: 159:270/312 of query aligns to 143:260/287 of 1lkdA
Sites not aligning to the query:
1lgtA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase (dhbd) complexed with 2'-cl dihydroxybiphenyl (dhb) (see paper)
32% identity, 36% coverage: 159:270/312 of query aligns to 143:260/287 of 1lgtA
1hanA Crystal structure of the biphenyl-cleaving extradiol dioxygenase from a pcb-degrading pseudomonad (see paper)
32% identity, 36% coverage: 159:270/312 of query aligns to 143:260/287 of 1hanA
Sites not aligning to the query:
1knfA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 3-methyl catechol under anaerobic condition (see paper)
33% identity, 36% coverage: 159:270/312 of query aligns to 143:260/288 of 1knfA
1kndA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with catechol under anaerobic condition (see paper)
33% identity, 36% coverage: 159:270/312 of query aligns to 143:260/288 of 1kndA
1kmyA Crystal structure of 2,3-dihydroxybiphenyl 1,2-dioxygenase complexed with 2,3-dihydroxybiphenyl under anaerobic condition (see paper)
33% identity, 36% coverage: 159:270/312 of query aligns to 143:260/288 of 1kmyA
>RR42_RS34600 FitnessBrowser__Cup4G11:RR42_RS34600
MEDNNEAREREPAVHSLDHYALTVPDLSAAEHFLGAFGLTVVRQDDTLEVLAQDGWVWAR
YFPGERKALAYLSFNCFAGDFEGIRRKLLAANVTFASGAAHATAEGLWFLDADGNLIQVK
IGPKTSPSAKNPLKDIHGPADMRGAAFRDQVGKVRPRRLSHVLLFTPDVSRAVSFYNDTL
GLRLSDRSGDGIAFLHAPHGCDHHLLAFAKSSARGWHHAAWDVASVDEVGQGAGQMAVAG
YKEGWGTGRHVLGSNFFHYVRDPWGSFCEYSADIDYISAGHAWPAGDYPPEDSLYQWGPD
VPPYFIHNTEAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory