SitesBLAST
Comparing RR42_RS34610 FitnessBrowser__Cup4G11:RR42_RS34610 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1wwkA Crystal structure of phosphoglycerate dehydrogenase from pyrococcus horikoshii ot3
41% identity, 93% coverage: 4:312/331 of query aligns to 2:304/304 of 1wwkA
- active site: S96 (≠ N104), R230 (= R238), D254 (= D262), E259 (= E267), H278 (= H286)
- binding nicotinamide-adenine-dinucleotide: V100 (= V108), G146 (= G153), F147 (= F154), G148 (= G155), R149 (≠ Q156), I150 (≠ V157), Y168 (≠ F175), D169 (= D176), P170 (= P177), V201 (= V209), P202 (= P210), T207 (= T215), T228 (= T236), S229 (≠ A237), D254 (= D262), H278 (= H286), G280 (= G288)
5aovA Ternary crystal structure of pyrococcus furiosus glyoxylate hydroxypyruvate reductase in presence of glyoxylate (see paper)
36% identity, 85% coverage: 51:330/331 of query aligns to 46:332/334 of 5aovA
- active site: L100 (≠ N104), R241 (= R238), D265 (= D262), E270 (= E267), H288 (= H286)
- binding glyoxylic acid: M52 (≠ R57), L53 (vs. gap), L53 (vs. gap), Y74 (≠ H78), A75 (≠ G79), V76 (= V80), G77 (= G81), R241 (= R238), H288 (= H286)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: V76 (= V80), T104 (≠ V108), F158 (= F154), G159 (= G155), R160 (≠ Q156), I161 (≠ V157), S180 (≠ D176), R181 (≠ P177), A211 (≠ H208), V212 (= V209), P213 (= P210), T218 (= T215), I239 (≠ T236), A240 (= A237), R241 (= R238), H288 (= H286), G290 (= G288)
O43175 D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; Malate dehydrogenase; EC 1.1.1.95; EC 1.1.1.399; EC 1.1.1.37 from Homo sapiens (Human) (see 3 papers)
32% identity, 96% coverage: 12:328/331 of query aligns to 15:323/533 of O43175
- T78 (≠ V80) binding
- R135 (= R137) to W: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606949
- RI 155:156 (≠ QV 156:157) binding
- D175 (= D176) binding
- T207 (≠ V209) binding
- CAR 234:236 (≠ TAR 236:238) binding
- D260 (= D262) binding
- V261 (≠ T263) to M: in PHGDHD; results in a four-fold decrease in substrate affinity and a slight increase in maximal enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs267606947
- HLGA 283:286 (≠ HVGG 286:289) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylalanine
- 373 A → T: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs201553627
- 377 G → S: in PHGDHD; results in a 2-fold decrease in enzyme activity with 3-phosphohydroxypyruvate, but no change in substrate affinity; dbSNP:rs267606948
- 425 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907988
- 490 V → M: in PHGDHD; results in almost undetectable enzyme activity with 3-phosphohydroxypyruvate; dbSNP:rs121907987
3ddnB Crystal structure of hydroxypyruvic acid phosphate bound d-3- phosphoglycerate dehydrogenase in mycobacterium tuberculosis (see paper)
41% identity, 82% coverage: 44:313/331 of query aligns to 35:305/525 of 3ddnB
3dc2A Crystal structure of serine bound d-3-phosphoglycerate dehydrogenase from mycobacterium tuberculosis (see paper)
41% identity, 82% coverage: 44:313/331 of query aligns to 34:304/526 of 3dc2A
Sites not aligning to the query:
6plfA Crystal structure of human phgdh complexed with compound 1 (see paper)
32% identity, 91% coverage: 12:312/331 of query aligns to 11:305/305 of 6plfA
6rj5A Crystal structure of phgdh in complex with compound 39 (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 10:295/301 of 6rj5A
P87228 Putative D-3-phosphoglycerate dehydrogenase; 3-PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
34% identity, 83% coverage: 20:294/331 of query aligns to 72:352/466 of P87228
- S87 (≠ G35) modified: Phosphoserine
- S258 (≠ N212) modified: Phosphoserine
7dkmA Phgdh covalently linked to oridonin (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 11:296/306 of 7dkmA
- binding nicotinamide-adenine-dinucleotide: T74 (≠ V80), A102 (≠ V108), G148 (= G153), R151 (≠ Q156), I152 (≠ V157), Y170 (≠ F175), D171 (= D176), P172 (= P177), I173 (≠ A178), H202 (= H208), T203 (≠ V209), P204 (= P210), T209 (= T215), C230 (≠ T236), A231 (= A237), R232 (= R238), H279 (= H286), G281 (= G288)
- binding (1beta,6beta,7beta,8alpha,9beta,10alpha,13alpha,14R,16beta)-1,6,7,14-tetrahydroxy-7,20-epoxykauran-15-one: C14 (≠ A15), K17 (≠ R18), I18 (≠ L19), E293 (≠ S300)
6rj2A Crystal structure of phgdh in complex with compound 40 (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 7:292/299 of 6rj2A
- binding ~{N}-[(1~{R})-1-[4-(ethanoylsulfamoyl)phenyl]ethyl]-2-methyl-5-phenyl-pyrazole-3-carboxamide: G146 (= G155), I148 (≠ V157), Y166 (≠ F175), D167 (= D176), P168 (= P177), I169 (≠ A178), I170 (≠ L179), H198 (= H208), T199 (≠ V209), L208 (≠ M218), R228 (= R238)
6plfB Crystal structure of human phgdh complexed with compound 1 (see paper)
34% identity, 88% coverage: 12:303/331 of query aligns to 9:286/292 of 6plfB
- binding 4-{(1S)-1-[(5-chloro-6-{[(5S)-2-oxo-1,3-oxazolidin-5-yl]methoxy}-1H-indole-2-carbonyl)amino]-2-hydroxyethyl}benzoic acid: R141 (≠ Q156), Y160 (≠ F175), D161 (= D176), P162 (= P177), I164 (≠ L179), L179 (= L195), T193 (≠ V209), P194 (= P210), S198 (≠ H214), L202 (≠ M218)
6cwaA Crystal structure phgdh in complex with nadh and 3-phosphoglycerate at 1.77 a resolution (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 9:294/299 of 6cwaA
- binding 1,4-dihydronicotinamide adenine dinucleotide: N96 (= N104), A100 (≠ V108), R149 (≠ Q156), I150 (≠ V157), Y168 (≠ F175), D169 (= D176), P170 (= P177), I171 (≠ A178), H200 (= H208), T201 (≠ V209), P202 (= P210), T207 (= T215), C228 (≠ T236), A229 (= A237), R230 (= R238), H277 (= H286), G279 (= G288)
7ewhA Crystal structure of human phgdh in complex with homoharringtonine (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 10:295/302 of 7ewhA
- binding (3beta)-O~3~-[(2R)-2,6-dihydroxy-2-(2-methoxy-2-oxoethyl)-6-methylheptanoyl]cephalotaxine: L146 (≠ V152), G147 (= G153), L148 (≠ F154), G149 (= G155), R150 (≠ Q156), I151 (≠ V157), G152 (≠ A158), D170 (= D176), H201 (= H208), T202 (≠ V209), P203 (= P210)
6rihA Crystal structure of phgdh in complex with compound 9 (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 10:295/302 of 6rihA
6plgA Crystal structure of human phgdh complexed with compound 15 (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 10:295/303 of 6plgA
6rj3A Crystal structure of phgdh in complex with compound 15 (see paper)
32% identity, 88% coverage: 12:303/331 of query aligns to 9:294/297 of 6rj3A
2p9eA Crystal structure of g336v mutant of e.Coli phosphoglycerate dehydrogenase (see paper)
37% identity, 77% coverage: 56:309/331 of query aligns to 57:311/406 of 2p9eA
- active site: N104 (= N104), R236 (= R238), D260 (= D262), E265 (= E267), H288 (= H286)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G156 (= G155), H157 (≠ Q156), I158 (≠ V157), Y176 (≠ F175), D177 (= D176), I178 (≠ P177), H206 (= H208), V207 (= V209), P208 (= P210), S212 (≠ H214), A234 (≠ T236), S235 (≠ A237), R236 (= R238), H288 (= H286), G290 (= G288)
2eklA Structure of st1218 protein from sulfolobus tokodaii
32% identity, 92% coverage: 6:311/331 of query aligns to 8:307/312 of 2eklA
- active site: S100 (≠ N104), R232 (= R238), D256 (= D262), E261 (= E267), H282 (= H286)
- binding nicotinamide-adenine-dinucleotide: I76 (≠ V80), S100 (≠ N104), G148 (= G153), G150 (= G155), R151 (≠ Q156), I152 (≠ V157), Y170 (≠ F175), D171 (= D176), I172 (≠ A178), L173 (= L179), H202 (= H208), V203 (= V209), T204 (≠ P210), I212 (≠ M218), T230 (= T236), S231 (≠ A237), D256 (= D262), G284 (= G288)
1ybaA The active form of phosphoglycerate dehydrogenase (see paper)
37% identity, 77% coverage: 56:309/331 of query aligns to 57:311/406 of 1ybaA
- active site: N104 (= N104), R236 (= R238), D260 (= D262), E265 (= E267), H288 (= H286)
- binding 2-oxoglutaric acid: S57 (= S56), C79 (≠ G79), I80 (≠ V80)
- binding nicotinamide-adenine-dinucleotide: I80 (≠ V80), F102 (≠ G102), V108 (= V108), G154 (= G153), G156 (= G155), H157 (≠ Q156), I158 (≠ V157), Y176 (≠ F175), D177 (= D176), I178 (≠ P177), K181 (≠ A183), H206 (= H208), V207 (= V209), P208 (= P210), A234 (≠ T236), S235 (≠ A237), R236 (= R238), H288 (= H286), G290 (= G288)
- binding phosphate ion: G81 (= G81), N83 (≠ S83)
Sites not aligning to the query:
P0A9T0 D-3-phosphoglycerate dehydrogenase; PGDH; 2-oxoglutarate reductase; EC 1.1.1.95; EC 1.1.1.399 from Escherichia coli (strain K12) (see 2 papers)
37% identity, 77% coverage: 56:309/331 of query aligns to 61:315/410 of P0A9T0
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
Query Sequence
>RR42_RS34610 FitnessBrowser__Cup4G11:RR42_RS34610
MPTTVLVTAPRLAPAGVRLLEAAGARILYLADANGANDAGEVARILAAEPVDAVISRTVA
LSGAAIAACPTLKVISKHGVGVSNIDVQAATARGIPVYVTPGANARSVAELTLALMFAAA
RRVAWMDRELHAGRWSRAQDGIELHGRTLGLVGFGQVARRVATVCLALGMPVVAFDPALA
GRASPVAGVALADSLDALLAASDVLSLHVPLNQHTRNMLAAPQFARMRRGAILINTARGE
VVDEAALVAALQGGQLYAAGLDTMAVEPLPAHSPLSALDNVVLTPHVGGSTPAALAAMAS
DAARNVLGFLQGKPPAATACVNPQVLAAPGA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory