Comparing RR42_RS34685 FitnessBrowser__Cup4G11:RR42_RS34685 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3n9tA Cryatal structure of hydroxyquinol 1,2-dioxygenase from pseudomonas putida dll-e4
37% identity, 96% coverage: 1:276/288 of query aligns to 8:284/286 of 3n9tA
Q5PXQ6 Hydroxyquinol 1,2-dioxygenase; 1,2-HQD; EC 1.13.11.37 from Nocardioides simplex (Arthrobacter simplex) (see paper)
38% identity, 95% coverage: 4:278/288 of query aligns to 16:293/293 of Q5PXQ6
1tmxA Crystal structure of hydroxyquinol 1,2-dioxygenase from nocardioides simplex 3e (see paper)
38% identity, 95% coverage: 4:278/288 of query aligns to 15:292/292 of 1tmxA
5umhB Crystal structure of catechol 1,2-dioxygenase protein from burkholderia multivorans
34% identity, 93% coverage: 11:277/288 of query aligns to 23:291/310 of 5umhB
2azqA Crystal structure of catechol 1,2-dioxygenase from pseudomonas arvilla c-1 (see paper)
31% identity, 91% coverage: 15:276/288 of query aligns to 26:289/309 of 2azqA
2boyA Crystal structure of 3-chlorocatechol 1,2-dioxygenase from rhodococcus opacus 1cp (see paper)
31% identity, 86% coverage: 12:258/288 of query aligns to 1:240/253 of 2boyA
3o6rA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
31% identity, 91% coverage: 16:276/288 of query aligns to 4:254/256 of 3o6rA
3o6jA Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with hydroxyquinol (see paper)
31% identity, 91% coverage: 16:276/288 of query aligns to 4:254/256 of 3o6jA
3o32A Crystal structure of 4-chlorocatechol dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
31% identity, 91% coverage: 16:276/288 of query aligns to 4:254/256 of 3o32A
3i51A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4,5-dichlorocatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3i51A
Sites not aligning to the query:
3i4yA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3,5-dichlorocatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3i4yA
Sites not aligning to the query:
3i4vA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-chlorocatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3i4vA
3hjsA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-methylcatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3hjsA
Sites not aligning to the query:
3hjqA Crystal structure of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 3-methylcatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3hjqA
Sites not aligning to the query:
3hhyA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with catechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3hhyA
Sites not aligning to the query:
3hhxA Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with pyrogallol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 74:255/256 of 3hhxA
Sites not aligning to the query:
3hj8A Crystal structure determination of catechol 1,2-dioxygenase from rhodococcus opacus 1cp in complex with 4-chlorocatechol (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 75:256/257 of 3hj8A
Sites not aligning to the query:
3hgiA Crystal structure of catechol 1,2-dioxygenase from the gram-positive rhodococcus opacus 1cp (see paper)
36% identity, 66% coverage: 88:277/288 of query aligns to 76:257/258 of 3hgiA
3th1A Crystal structure of chlorocatechol 1,2-dioxygenase from pseudomonas putida
32% identity, 81% coverage: 14:246/288 of query aligns to 2:226/246 of 3th1A
2xsrA Crystal structure of wild type acinetobacter radioresistens catechol 1,2 dioxygenase (see paper)
31% identity, 100% coverage: 1:288/288 of query aligns to 9:303/309 of 2xsrA
>RR42_RS34685 FitnessBrowser__Cup4G11:RR42_RS34685
MSQLVKQAMRDTTDPRLREVVEALVDHLHAFLRQVRPSDEEFEAGLRFVAALGHATHATN
NEVVLAADVLGLSTLVTLMNNGITGGRTPGALLGPFYRGGAPSYACGDCVVQGETPGLPL
FVRGQVRNTAGEPLAGALVEAWQASPVGLYDNQDPSQPDKNLRGAFRADAQGRFHFRSVR
PAGYPVPTGGPVGQLLAEQNRHPYRPAHIHFIAAAPGYRTLVTQVFADDSEHLESDVTFG
VHRELVGHFRRVDEGTSPWGGFPAPFYTLDFNFVLEPGEQTFPTPPID
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory