Comparing RR42_RS34800 RR42_RS34800 leucine/isoleucine/valine transporter ATP-binding subunit to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
47% identity, 100% coverage: 1:234/235 of query aligns to 6:238/240 of 1ji0A
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 100% coverage: 1:234/235 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
26% identity, 100% coverage: 1:234/235 of query aligns to 4:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
28% identity, 100% coverage: 1:234/235 of query aligns to 2:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
29% identity, 99% coverage: 2:234/235 of query aligns to 3:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
29% identity, 99% coverage: 2:234/235 of query aligns to 3:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
29% identity, 99% coverage: 2:234/235 of query aligns to 3:235/235 of 6mhzA
6mbnA Lptb e163q in complex with atp (see paper)
29% identity, 99% coverage: 2:234/235 of query aligns to 4:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
29% identity, 99% coverage: 2:233/235 of query aligns to 3:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
29% identity, 99% coverage: 2:233/235 of query aligns to 3:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
29% identity, 98% coverage: 2:232/235 of query aligns to 3:233/233 of 6b8bA
3d31A Modbc from methanosarcina acetivorans (see paper)
30% identity, 100% coverage: 1:234/235 of query aligns to 1:229/348 of 3d31A
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
30% identity, 85% coverage: 16:214/235 of query aligns to 19:218/230 of 6z4wA
Sites not aligning to the query:
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
30% identity, 85% coverage: 16:214/235 of query aligns to 19:218/229 of 6z67B
Sites not aligning to the query:
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
30% identity, 87% coverage: 13:216/235 of query aligns to 17:222/343 of P30750
Sites not aligning to the query:
A5U7B7 Cell division ATP-binding protein FtsE from Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) (see 2 papers)
31% identity, 93% coverage: 1:219/235 of query aligns to 1:222/229 of A5U7B7
8iddA Cryo-em structure of mycobacterium tuberculosis atp bound ftsex/ripc complex in peptidisc (see paper)
31% identity, 93% coverage: 1:219/235 of query aligns to 2:223/225 of 8iddA
8igqA Cryo-em structure of mycobacterium tuberculosis adp bound ftsex/ripc complex in peptidisc (see paper)
31% identity, 93% coverage: 1:219/235 of query aligns to 2:223/227 of 8igqA
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 92% coverage: 1:217/235 of query aligns to 2:218/241 of 4u00A
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
30% identity, 87% coverage: 13:216/235 of query aligns to 18:223/344 of 3tuzC
Sites not aligning to the query:
>RR42_RS34800 RR42_RS34800 leucine/isoleucine/valine transporter ATP-binding subunit
MLQLERVSLSYGSFRALDNITLNAAAGELVVLLGANGAGKSSIFMALSGIHRTSGGSMRF
DGRELAGMKPSQIVQAGLVHCPEGRKLFPAMSVQKNLTLGAYVHRRDSAGIKRSLEDVFE
MFPILRQKKDDPAGSLSGGQQQMVALGRALMGRPRTLLLDEPSLGLAPLVVKQMFEVIQR
INRAGTTVLLAEQNAYAALGIAHRAYVIESGRIVMQGDRDALLKDEGIRRAYIGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory