SitesBLAST
Comparing RR42_RS35120 FitnessBrowser__Cup4G11:RR42_RS35120 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ewyA Anabaena pcc7119 ferredoxin:ferredoxin-NADP+-reductase complex (see paper)
35% identity, 66% coverage: 145:426/426 of query aligns to 13:303/303 of 1ewyA
- active site: Y79 (= Y214), S80 (= S215), C261 (= C384), E301 (= E424), Y303 (= Y426)
- binding flavin-adenine dinucleotide: R77 (= R212), L78 (≠ Q213), Y79 (= Y214), S80 (= S215), C98 (≠ T233), L102 (≠ V237), Y104 (≠ E239), G115 (= G248), V116 (= V249), C117 (≠ A250), S118 (= S251), E301 (= E424), Y303 (= Y426)
1queA X-ray structure of the ferredoxin:nadp+ reductase from the cyanobacterium anabaena pcc 7119 at 1.8 angstroms (see paper)
35% identity, 66% coverage: 145:426/426 of query aligns to 13:303/303 of 1queA
- active site: Y79 (= Y214), S80 (= S215), C261 (= C384), E301 (= E424), Y303 (= Y426)
- binding flavin-adenine dinucleotide: R77 (= R212), L78 (≠ Q213), Y79 (= Y214), S80 (= S215), C98 (≠ T233), L102 (≠ V237), Y104 (≠ E239), K105 (≠ D240), G115 (= G248), V116 (= V249), C117 (≠ A250), S118 (= S251), T157 (= T290), E301 (= E424), Y303 (= Y426)
- binding sulfate ion: S223 (= S349), R224 (= R350), R233 (≠ K356), Y235 (= Y358)
1gjrA Ferredoxin-NADP+ reductase complexed with NADP+ by cocrystallization (see paper)
35% identity, 66% coverage: 145:426/426 of query aligns to 5:295/295 of 1gjrA
- active site: Y71 (= Y214), S72 (= S215), C253 (= C384), E293 (= E424), Y295 (= Y426)
- binding flavin-adenine dinucleotide: R69 (= R212), L70 (≠ Q213), Y71 (= Y214), S72 (= S215), C90 (≠ T233), L94 (≠ V237), Y96 (≠ E239), G107 (= G248), V108 (= V249), C109 (≠ A250), S110 (= S251), T149 (= T290), E293 (= E424), Y295 (= Y426)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R92 (≠ K235), L94 (≠ V237), T147 (= T288), G148 (= G289), T149 (= T290), P186 (≠ R323), S215 (= S349), R216 (= R350), R225 (≠ K356), Y227 (= Y358), Q229 (= Q360), G254 (= G385), L255 (= L386), Y295 (= Y426)
1gawB Crystal structure analysis of the ferredoxin-NADP+ reductase from maize leaf (see paper)
34% identity, 66% coverage: 144:426/426 of query aligns to 20:305/305 of 1gawB
- active site: Y86 (= Y214), S87 (= S215), C263 (= C384), E303 (= E424), Y305 (= Y426)
- binding flavin-adenine dinucleotide: R84 (= R212), L85 (≠ Q213), Y86 (= Y214), S87 (= S215), C105 (≠ T233), Y111 (vs. gap), G121 (= G248), V122 (= V249), C123 (≠ A250), S124 (= S251), T163 (= T290), Y305 (= Y426)
3vo2A Crystal structure of zea mays leaf ferredoxin-NADP+ reductase iii (see paper)
35% identity, 62% coverage: 161:426/426 of query aligns to 25:296/296 of 3vo2A
- active site: Y77 (= Y214), S78 (= S215), C254 (= C384), E294 (= E424), Y296 (= Y426)
- binding flavin-adenine dinucleotide: R75 (= R212), L76 (≠ Q213), Y77 (= Y214), S78 (= S215), C96 (≠ T233), V97 (≠ I234), L100 (vs. gap), Y102 (≠ L238), G112 (= G248), V113 (= V249), C114 (≠ A250), S115 (= S251), T154 (= T290), E294 (= E424), Y296 (= Y426)
2b5oA Ferredoxin-NADP reductase
35% identity, 62% coverage: 161:426/426 of query aligns to 18:292/292 of 2b5oA
- active site: Y71 (= Y214), S72 (= S215), C250 (= C384), E290 (= E424), Y292 (= Y426)
- binding flavin-adenine dinucleotide: R69 (= R212), L70 (≠ Q213), Y71 (= Y214), S72 (= S215), C90 (≠ T233), Y96 (vs. gap), G107 (= G248), V108 (= V249), C109 (≠ A250), S110 (= S251), T150 (= T290), E290 (= E424), Y292 (= Y426)
P10933 Ferredoxin--NADP reductase, leaf isozyme, chloroplastic; FNR; EC 1.18.1.2 from Pisum sativum (Garden pea) (Lathyrus oleraceus) (see 2 papers)
36% identity, 62% coverage: 163:426/426 of query aligns to 91:360/360 of P10933
- RLYS 139:142 (≠ RQYS 212:215) binding
- S142 (= S215) binding
- CVK 160:162 (≠ TIK 233:235) binding
- K162 (= K235) binding
- Y166 (≠ L238) binding
- VCS 177:179 (≠ VAS 249:251) binding
- T218 (= T290) binding
- VP 250:251 (≠ AR 322:323) binding
- SR 280:281 (= SR 349:350) binding
- K290 (= K356) binding
- GL 319:320 (= GL 385:386) binding
- E358 (= E424) binding
- Y360 (= Y426) mutation to F: Results in a 2.0-fold reduction in kcat for the diaphorase reaction.; mutation to G: Results in a 302-fold reduction in kcat for the diaphorase reaction.; mutation to S: Results in a 22-fold reduction in kcat for the diaphorase reaction.; mutation to W: Results in a 2.2-fold reduction in kcat for the diaphorase reaction.
3mhpA Fnr-recruitment to the thylakoid (see paper)
36% identity, 62% coverage: 163:426/426 of query aligns to 26:295/296 of 3mhpA
- active site: Y76 (= Y214), S77 (= S215), C253 (= C384), E293 (= E424), Y295 (= Y426)
- binding flavin-adenine dinucleotide: R74 (= R212), L75 (≠ Q213), Y76 (= Y214), S77 (= S215), C95 (≠ T233), L99 (vs. gap), G111 (= G248), V112 (= V249), C113 (≠ A250), S114 (= S251), T153 (= T290), E293 (= E424), Y295 (= Y426)
- binding : T27 (≠ A164), K28 (≠ R165), I29 (≠ V166), H40 (= H177), F86 (≠ R224), G87 (≠ P225), W163 (= W301), F167 (≠ L305), E168 (≠ R306), K169 (= K307), E171 (≠ G309), S188 (≠ Q325), S189 (≠ E326), E195 (≠ G332), E196 (≠ P333), K199 (≠ S336), K203 (vs. gap)
Sites not aligning to the query:
1qgaA Pea fnr y308w mutant in complex with NADP+ (see paper)
35% identity, 62% coverage: 163:426/426 of query aligns to 39:308/308 of 1qgaA
- active site: Y89 (= Y214), S90 (= S215), C266 (= C384), E306 (= E424), W308 (≠ Y426)
- binding flavin-adenine dinucleotide: R87 (= R212), L88 (≠ Q213), Y89 (= Y214), S90 (= S215), C108 (≠ T233), L112 (vs. gap), Y114 (≠ L238), G124 (= G248), V125 (= V249), C126 (≠ A250), S127 (= S251), T166 (= T290), W308 (≠ Y426)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S215), K110 (= K235), G165 (= G289), T166 (= T290), G167 (= G291), V198 (≠ A322), P199 (≠ R323), S228 (= S349), R229 (= R350), K238 (= K356), Y240 (= Y358), Q242 (= Q360), C266 (= C384), G267 (= G385), L268 (= L386), E306 (= E424), W308 (≠ Y426)
1qfzA Pea fnr y308s mutant in complex with NADPH (see paper)
35% identity, 62% coverage: 163:425/426 of query aligns to 39:307/308 of 1qfzA
- active site: Y89 (= Y214), S90 (= S215), C266 (= C384), E306 (= E424)
- binding flavin-adenine dinucleotide: R87 (= R212), L88 (≠ Q213), Y89 (= Y214), S90 (= S215), C108 (≠ T233), K110 (= K235), L112 (vs. gap), Y114 (≠ L238), G124 (= G248), V125 (= V249), C126 (≠ A250), S127 (= S251), T166 (= T290)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: S90 (= S215), K110 (= K235), G165 (= G289), T166 (= T290), G167 (= G291), V198 (≠ A322), P199 (≠ R323), S228 (= S349), R229 (= R350), Y240 (= Y358), C266 (= C384), G267 (= G385), L268 (= L386), G270 (≠ S388), E306 (= E424)
Sites not aligning to the query:
1qfyA Pea fnr y308s mutant in complex with NADP+ (see paper)
35% identity, 62% coverage: 163:425/426 of query aligns to 39:307/308 of 1qfyA
- active site: Y89 (= Y214), S90 (= S215), C266 (= C384), E306 (= E424)
- binding flavin-adenine dinucleotide: R87 (= R212), L88 (≠ Q213), Y89 (= Y214), S90 (= S215), C108 (≠ T233), L112 (vs. gap), Y114 (≠ L238), G124 (= G248), V125 (= V249), C126 (≠ A250), S127 (= S251), T166 (= T290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S90 (= S215), K110 (= K235), G165 (= G289), T166 (= T290), G167 (= G291), V198 (≠ A322), P199 (≠ R323), S228 (= S349), R229 (= R350), K238 (= K356), Y240 (= Y358), Q242 (= Q360), C266 (= C384), G267 (= G385), L268 (= L386), G270 (≠ S388), M271 (= M389), E306 (= E424)
Sites not aligning to the query:
P00455 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Spinacia oleracea (Spinach) (see 3 papers)
34% identity, 62% coverage: 163:426/426 of query aligns to 100:369/369 of P00455
- RLYS 148:151 (≠ RQYS 212:215) binding
- CVK 169:171 (≠ TIK 233:235) binding
- Y175 (vs. gap) binding
- VCS 186:188 (≠ VAS 249:251) binding
- T227 (= T290) binding
- E367 (= E424) mutation to A: Slightly reduced activity.; mutation E->D,Q: Reduced activity.; mutation to L: Reduces activity by 99%.
Sites not aligning to the query:
- 1:55 modified: transit peptide, Chloroplast
2vzlA Ferredoxin-NADP reductase (mutations: t155g, a160t, l263p and y303s) complexed with NAD by cocrystallization (see paper)
34% identity, 66% coverage: 145:425/426 of query aligns to 5:294/295 of 2vzlA
- active site: Y71 (= Y214), S72 (= S215), C253 (= C384), E293 (= E424)
- binding flavin-adenine dinucleotide: R69 (= R212), L70 (≠ Q213), Y71 (= Y214), S72 (= S215), C90 (≠ T233), L94 (≠ V237), Y96 (≠ E239), G107 (= G248), V108 (= V249), C109 (≠ A250), S110 (= S251), T149 (= T290), E293 (= E424)
- binding nicotinamide-adenine-dinucleotide: S72 (= S215), R92 (≠ K235), T149 (= T290), C253 (= C384), G254 (= G385), P255 (≠ L386), E293 (= E424)
Sites not aligning to the query:
1fncA Refined crystal structure of spinach ferredoxin reductase at 1.7 angstroms resolution: oxidized, reduced, and 2'-phospho-5'-amp bound states (see paper)
34% identity, 62% coverage: 163:426/426 of query aligns to 27:296/296 of 1fncA
- active site: Y77 (= Y214), S78 (= S215), C254 (= C384), E294 (= E424), Y296 (= Y426)
- binding adenosine-2'-5'-diphosphate: K98 (= K235), V186 (≠ A322), P187 (≠ R323), S216 (= S349), R217 (= R350), K226 (= K356), Y228 (= Y358), L256 (= L386), G258 (≠ S388)
- binding dihydroflavine-adenine dinucleotide: R75 (= R212), L76 (≠ Q213), Y77 (= Y214), S78 (= S215), C96 (≠ T233), L100 (≠ V237), Y102 (vs. gap), G112 (= G248), V113 (= V249), C114 (≠ A250), S115 (= S251), T154 (= T290), E294 (= E424), Y296 (= Y426)
1bx0A Ferredoxin:nadp+ oxidoreductase (ferredoxin reductase) mutant e312l (see paper)
34% identity, 62% coverage: 163:426/426 of query aligns to 27:296/296 of 1bx0A
- active site: Y77 (= Y214), S78 (= S215), C254 (= C384), L294 (≠ E424), Y296 (= Y426)
- binding flavin-adenine dinucleotide: R75 (= R212), L76 (≠ Q213), Y77 (= Y214), S78 (= S215), C96 (≠ T233), Y102 (vs. gap), G112 (= G248), V113 (= V249), C114 (≠ A250), S115 (= S251), T154 (= T290), Y296 (= Y426)
5h59A Ferredoxin-NADP+ reductase from maize root (see paper)
34% identity, 68% coverage: 138:426/426 of query aligns to 14:311/311 of 5h59A
- active site: Y88 (= Y214), S89 (= S215), F268 (≠ V383), C269 (= C384), E309 (= E424), Y311 (= Y426)
- binding flavin-adenine dinucleotide: R86 (= R212), L87 (≠ Q213), Y88 (= Y214), S89 (= S215), C107 (≠ T233), Y113 (vs. gap), K125 (≠ R247), G127 (= G248), V128 (= V249), C129 (≠ A250), S130 (= S251), T170 (= T290), Y311 (= Y426)
5vw4A Nicotinamide soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 68% coverage: 138:425/426 of query aligns to 12:308/309 of 5vw4A
- active site: Y86 (= Y214), S87 (= S215), F266 (≠ V383), C267 (= C384), E307 (= E424)
- binding flavin-adenine dinucleotide: R84 (= R212), L85 (≠ Q213), Y86 (= Y214), S87 (= S215), C105 (≠ T233), A109 (≠ V237), Y111 (vs. gap), K123 (≠ R247), G125 (= G248), V126 (= V249), C127 (≠ A250), S128 (= S251), T168 (= T290)
- binding nicotinamide: S87 (= S215), T168 (= T290), G169 (= G291), C267 (= C384), G268 (= G385), E307 (= E424), V308 (≠ T425)
Sites not aligning to the query:
5vw2A NADPH soak of y316s mutant of corn root ferredoxin:nadp+ reductase (see paper)
34% identity, 68% coverage: 138:425/426 of query aligns to 12:308/309 of 5vw2A
- active site: Y86 (= Y214), S87 (= S215), F266 (≠ V383), C267 (= C384), E307 (= E424)
- binding dihydroflavine-adenine dinucleotide: R84 (= R212), L85 (≠ Q213), Y86 (= Y214), S87 (= S215), C105 (≠ T233), A109 (≠ V237), Y111 (vs. gap), K123 (≠ R247), G125 (= G248), V126 (= V249), C127 (≠ A250), S128 (= S251), T168 (= T290)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S87 (= S215), R107 (≠ K235), T166 (= T288), G167 (= G289), T168 (= T290), G169 (= G291), G199 (= G321), V200 (≠ A322), A201 (≠ R323), S230 (≠ G353), R231 (≠ Q354), K240 (vs. gap), Y242 (= Y358), Q244 (= Q360), G268 (= G385), L269 (= L386), G271 (≠ S388), M272 (= M389), E307 (= E424), V308 (≠ T425)
Sites not aligning to the query:
P53991 Ferredoxin--NADP reductase, chloroplastic; FNR; EC 1.18.1.2 from Chlamydomonas reinhardtii (Chlamydomonas smithii)
31% identity, 67% coverage: 141:426/426 of query aligns to 64:354/354 of P53991
- K118 (vs. gap) modified: N6,N6,N6-trimethyllysine
- K124 (≠ R207) modified: N6,N6,N6-trimethyllysine
- K170 (vs. gap) modified: N6,N6-dimethyllysine
Sites not aligning to the query:
- 1:35 modified: transit peptide, Chloroplast
2rc6A Refined structure of fnr from leptospira interrogans bound to NADP+ (see paper)
33% identity, 66% coverage: 144:426/426 of query aligns to 13:306/306 of 2rc6A
- active site: Y90 (= Y214), S91 (= S215), C264 (= C384), E304 (= E424), Y306 (= Y426)
- binding flavin-adenine dinucleotide: R88 (= R212), L89 (≠ Q213), Y90 (= Y214), S91 (= S215), I109 (≠ T233), I110 (= I234), D113 (≠ V237), I115 (≠ D240), F122 (≠ V246), G124 (= G248), V125 (= V249), C126 (≠ A250), S127 (= S251), T167 (= T290), E304 (= E424), Y306 (= Y426)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: K111 (= K235), T165 (= T288), G166 (= G289), A197 (= A322), P198 (≠ R323), S226 (= S349), R227 (= R350), R237 (≠ K356), Y239 (= Y358), P267 (≠ L386), M270 (= M389)
- binding zinc ion: E181 (≠ R304), H216 (≠ P338)
Query Sequence
>RR42_RS35120 FitnessBrowser__Cup4G11:RR42_RS35120
MDMSDIQVIRQHLIDPEICIRCNTCEATCPVAAITHDARNYVVDADKCNGCMACISPCPT
GSIDNWRTMPRAMAYGIVEQFGWDTLPDELSSEQLAAQGVAADAEPVLESAPASSLAAVT
GEDGFNSAQYGATVPPWSAAHAYTNLYGAKAAARSVTATVVGNARVTEVGRDYDTHHIVL
DFGSAPFPVLEGQSIGIVPPGVDASGRQHHARQYSLASPRNGERPGYNNISLTIKRVLED
HQGNPVRGVASNYMCDLQVGDKVDVIGPFGASFLMPNHPRSHIVMICTGTGSAPMRAMTE
WRRRLRKSGKFEGGKLMLFFGARTQEELPYFGPLQSLPKDFIDINFAFSRTPGQPKRYVQ
DVMRERAADLGPLLADPNTCFYVCGLKSMEEGVVLALRDVAQQAGLSWDAVGAALKKEGR
LHLETY
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory