SitesBLAST
Comparing RR42_RS35270 FitnessBrowser__Cup4G11:RR42_RS35270 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6iunB Crystal structure of enoyl-coa hydratase (ech) from ralstonia eutropha h16 in complex with NAD
50% identity, 99% coverage: 7:690/693 of query aligns to 1:691/692 of 6iunB
- active site: A60 (= A66), F65 (= F71), E73 (≠ G77), H77 (≠ A81), G101 (= G105), E104 (= E108), E124 (= E128), G132 (= G136), K248 (= K257), S407 (= S416), H428 (= H437), E440 (= E449), N478 (= N487)
- binding nicotinamide-adenine-dinucleotide: G300 (= G309), T301 (= T310), M302 (= M311), E321 (= E330), T322 (= T331), Y365 (≠ L374), A377 (= A386), V378 (= V387), E380 (= E389), V384 (= V393), V388 (≠ I397), N405 (= N414), S407 (= S416)
Q08426 Peroxisomal bifunctional enzyme; PBE; PBFE; L-bifunctional protein; LBP; Multifunctional enzyme 1; MFE1; EC 4.2.1.17; EC 5.3.3.8; EC 1.1.1.35 from Homo sapiens (Human) (see 5 papers)
41% identity, 97% coverage: 16:686/693 of query aligns to 11:705/723 of Q08426
- V40 (≠ I45) to G: in dbSNP:rs1062551
- I41 (≠ A46) to R: in dbSNP:rs1062552
- T75 (≠ S79) to I: in dbSNP:rs1062553
- K165 (≠ E169) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-171; Q-346 and Q-584.
- K171 (≠ L175) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-346 and Q-584.
- A274 (= A281) to T: in dbSNP:rs2302819
- A325 (≠ I328) to G: in dbSNP:rs1062555
- K346 (≠ N349) modified: N6-acetyllysine; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-584.
- K584 (≠ E569) modified: N6-acetyllysine; alternate; mutation to Q: Greatly reduced acetylation and insensitive to treatment with TSA and NAM; when associated with Q-165; Q-171 and Q-346.
- K598 (≠ G581) to T: in dbSNP:rs1042437
- T606 (≠ R589) to P: in dbSNP:rs1042438
Sites not aligning to the query:
- 3 E → K: in FRTS3; the mutant is mistargeted to mitochondria; results in impaired mitochondrial oxidative phosphorylation and defects in the transport of fluids across the epithelium of renal proximal tubular cells; dbSNP:rs398124646
3zw9A Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with (2s,3s)-3-hydroxy-2- methylbutanoyl-coa (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 8:707/723 of 3zw9A
- active site: A64 (= A66), F69 (= F71), G79 (≠ A81), G103 (= G105), E106 (= E108), P125 (= P127), E126 (= E128), P133 (= P135), G134 (= G136), K252 (= K257), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding nicotinamide-adenine-dinucleotide: L305 (≠ I306), G306 (= G307), G308 (= G309), T309 (= T310), M310 (= M311), E329 (= E330), Q334 (≠ A335), A383 (= A386), V384 (= V387), F385 (≠ Y388), E386 (= E389), N411 (= N414), S413 (= S416), H434 (= H437)
- binding (2s,3s)-3-hydroxy-2-methylbutanoyl-coa: V24 (= V26), A62 (= A64), G63 (= G65), A64 (= A66), I66 (= I68), G102 (= G104), G103 (= G105), E106 (= E108), E126 (= E128), P133 (= P135), Y159 (≠ H161)
5omoA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with with 3s-hydroxy-decanoyl-coa and 3-keto- decanoyl-coa
41% identity, 98% coverage: 10:686/693 of query aligns to 10:709/725 of 5omoA
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), P135 (= P135), G136 (= G136), K254 (= K257), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (s)-3-hydroxydecanoyl-coa: P25 (= P25), V26 (= V26), A28 (= A28), P31 (≠ A31), A64 (= A64), A66 (= A66), D67 (= D67), I68 (= I68), L103 (= L103), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), Y161 (≠ H161), F260 (= F263), K280 (≠ R283)
- binding 3-keto-decanoyl-coa: S415 (= S416), N486 (= N487), K519 (≠ P520), M520 (= M521), V525 (≠ M526), Y658 (= Y637)
5mgbA Crystal structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and NAD (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 10:709/725 of 5mgbA
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), P135 (= P135), G136 (= G136), K254 (= K257), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding acetoacetyl-coenzyme a: P25 (= P25), V26 (= V26), A64 (= A64), G65 (= G65), A66 (= A66), D67 (= D67), I68 (= I68), G105 (= G105), E128 (= E128), Y161 (≠ H161)
- binding nicotinamide-adenine-dinucleotide: L307 (≠ I306), G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ T331), Q336 (≠ A335), V386 (= V387), F387 (≠ Y388), E388 (= E389), N413 (= N414), S415 (= S416), H436 (= H437)
3zwcA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-decanoyl-coa (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 10:709/725 of 3zwcA
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), P135 (= P135), G136 (= G136), K254 (= K257), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (s)-3-hydroxydecanoyl-coa: V26 (= V26), A64 (= A64), G65 (= G65), A66 (= A66), D67 (= D67), I68 (= I68), G77 (= G77), L78 (≠ P78), L80 (= L80), V101 (≠ T101), G104 (= G104), G105 (= G105), E108 (= E108), E128 (= E128), F260 (= F263)
- binding nicotinamide-adenine-dinucleotide: G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), Q336 (≠ A335), A385 (= A386), V386 (= V387), F387 (≠ Y388), E388 (= E389), K393 (= K394), N413 (= N414), S415 (= S416), H436 (= H437)
2x58A The crystal structure of mfe1 liganded with coa (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 10:709/725 of 2x58A
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), P135 (= P135), G136 (= G136), K254 (= K257), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding adenosine-5'-diphosphate: G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ T331), Q336 (≠ A335), V386 (= V387), L392 (≠ V393)
- binding coenzyme a: V26 (= V26), A28 (= A28), A64 (= A64), A66 (= A66), D67 (= D67), I68 (= I68), E128 (= E128)
3zwaA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 3s-hydroxy-hexanoyl-coa (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 11:710/727 of 3zwaA
- active site: A67 (= A66), F72 (= F71), G82 (≠ A81), G106 (= G105), E109 (= E108), P128 (= P127), E129 (= E128), P136 (= P135), G137 (= G136), K255 (= K257), S416 (= S416), H437 (= H437), E449 (= E449), N487 (= N487)
- binding (S)-3-Hydroxyhexanoyl-CoA: V27 (= V26), A65 (= A64), G66 (= G65), A67 (= A66), D68 (= D67), I69 (= I68), L104 (= L103), E109 (= E108), R124 (= R123), E129 (= E128), L132 (= L131), G137 (= G136), Y162 (≠ H161)
6zicAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with 3s-hydroxybutanoyl-coa and nadh'
41% identity, 98% coverage: 10:686/693 of query aligns to 10:707/723 of 6zicAAA
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), G136 (= G136), K254 (= K257), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding 3-hydroxybutanoyl-coenzyme a: P25 (= P25), V26 (= V26), A28 (= A28), A66 (= A66), D67 (= D67), I68 (= I68), G104 (= G104), G105 (= G105), E108 (= E108), E128 (= E128), Y161 (≠ H161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G308 (= G307), G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ T331), Q336 (≠ A335), A383 (= A386), V384 (= V387), F385 (≠ Y388), E386 (= E389), L390 (≠ V393), K391 (= K394), N411 (= N414), S413 (= S416), H434 (= H437)
6zibAAA structure of rat peroxisomal multifunctional enzyme type-1 (rpmfe1) complexed with acetoacetyl-coa and nadh'
41% identity, 98% coverage: 10:686/693 of query aligns to 10:707/723 of 6zibAAA
- active site: A66 (= A66), F71 (= F71), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), E128 (= E128), G136 (= G136), K254 (= K257), S413 (= S416), H434 (= H437), E446 (= E449), N484 (= N487)
- binding acetoacetyl-coenzyme a: P25 (= P25), V26 (= V26), A64 (= A64), G65 (= G65), A66 (= A66), D67 (= D67), I68 (= I68), G104 (= G104), G105 (= G105), E128 (= E128), Y161 (≠ H161)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G310 (= G309), T311 (= T310), M312 (= M311), E331 (= E330), S332 (≠ T331), Q336 (≠ A335), A383 (= A386), V384 (= V387), F385 (≠ Y388), E386 (= E389), N411 (= N414), H434 (= H437)
6z5oAAA Peroxisomal bifunctional enzyme (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 11:703/716 of 6z5oAAA
- active site: A67 (= A66), F72 (= F71), G82 (≠ A81), G106 (= G105), E109 (= E108), P128 (= P127), E129 (= E128), G137 (= G136), K255 (= K257), S409 (= S416), H430 (= H437), E442 (= E449), N480 (= N487)
- binding coenzyme a: P26 (= P25), V27 (= V26), A65 (= A64), D68 (= D67), I69 (= I68), P128 (= P127), Y162 (≠ H161), F277 (= F279), K281 (≠ R283)
- binding nicotinamide-adenine-dinucleotide: G309 (= G307), G311 (= G309), T312 (= T310), M313 (= M311), E332 (= E330), S333 (≠ T331), Q337 (≠ A335), A379 (= A386), V380 (= V387), F381 (≠ Y388), E382 (= E389), K387 (= K394), N407 (= N414), S409 (= S416), H430 (= H437)
- binding nicotinamide: A67 (= A66), E109 (= E108), E129 (= E128), P136 (= P135), F261 (= F263)
3zwbA Crystal structure of rat peroxisomal multifunctional enzyme type 1 (rpmfe1) complexed with 2trans-hexenoyl-coa (see paper)
41% identity, 98% coverage: 10:686/693 of query aligns to 10:709/725 of 3zwbA
- active site: A66 (= A66), G81 (≠ A81), G105 (= G105), E108 (= E108), P127 (= P127), A128 (≠ E128), P135 (= P135), G136 (= G136), S415 (= S416), H436 (= H437), E448 (= E449), N486 (= N487)
- binding (2E)-Hexenoyl-CoA: P25 (= P25), V26 (= V26), A28 (= A28), A64 (= A64), G65 (= G65), A66 (= A66), D67 (= D67), I68 (= I68), V101 (≠ T101), L103 (= L103), G105 (= G105), E108 (= E108), G136 (= G136), Y161 (≠ H161), K280 (≠ R283)
6yswA E. Coli anaerobic trifunctional enzyme subunit-alpha in complex with coenzyme a
34% identity, 97% coverage: 16:689/693 of query aligns to 13:702/707 of 6yswA
- active site: A66 (= A66), I71 (≠ F71), A84 (= A81), Q88 (vs. gap), G112 (= G105), E115 (= E108), P136 (= P127), E137 (= E128), G145 (= G136), D264 (≠ K257), S422 (= S416), H443 (= H437), E455 (= E449), N493 (= N487)
- binding coenzyme a: E23 (vs. gap), M25 (≠ V26), A66 (= A66), D67 (= D67), I68 (= I68), P136 (= P127), E137 (= E128), L140 (= L131), T290 (≠ R283), K293 (≠ W286)
P40939 Trifunctional enzyme subunit alpha, mitochondrial; 78 kDa gastrin-binding protein; Monolysocardiolipin acyltransferase; TP-alpha; EC 2.3.1.-; EC 4.2.1.17; EC 1.1.1.211 from Homo sapiens (Human) (see 5 papers)
32% identity, 98% coverage: 9:689/693 of query aligns to 42:761/763 of P40939
- V282 (≠ L219) to D: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852773
- I305 (= I241) to N: in MTPD1; mild phenotype with slowly progressive myopathy and sensorimotor polyneuropathy; dbSNP:rs137852774
- L342 (≠ Y278) to P: in LCHAD deficiency; dbSNP:rs137852772
- E510 (= E449) active site, For hydroxyacyl-coenzyme A dehydrogenase activity; to Q: in AFLP and LCHAD deficiency; loss of long-chain-3-hydroxyacyl-CoA dehydrogenase activity; dbSNP:rs137852769
1wdlA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) (see paper)
31% identity, 99% coverage: 6:689/693 of query aligns to 7:713/715 of 1wdlA
- active site: A69 (= A66), N89 (≠ A86), N93 (≠ S90), G117 (= G105), E120 (= E108), P139 (= P127), E140 (= E128), P147 (= P135), G148 (= G136), S430 (= S416), H451 (= H437), E463 (= E449), N501 (= N487)
- binding nicotinamide-adenine-dinucleotide: A322 (= A308), I324 (≠ T310), M325 (= M311), D344 (≠ E330), I345 (≠ T331), A400 (= A386), V401 (= V387), E403 (= E389), N428 (= N414), T429 (= T415), S430 (= S416)
P28793 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Pseudomonas fragi (see paper)
31% identity, 99% coverage: 6:689/693 of query aligns to 7:713/715 of P28793
P21177 Fatty acid oxidation complex subunit alpha; EC 4.2.1.17; EC 5.1.2.3; EC 5.3.3.8; EC 1.1.1.35 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 95% coverage: 12:666/693 of query aligns to 13:691/729 of P21177
- G116 (= G105) mutation to F: Absence of both enoyl-CoA hydratase and 3-hydroxyacyl-CoA epimerase activities. Delta(3)-cis-Delta(2)-trans-enoyl-CoA isomerase is only slightly affected.
- G322 (= G309) mutation to A: 10-fold increase in KM for NADH.
- H450 (= H437) active site, For 3-hydroxyacyl-CoA dehydrogenase activity; mutation H->A,Q: Almost complete loss of 3-hydroxyacyl-CoA dehydrogenase activity.
6tnmA E. Coli aerobic trifunctional enzyme subunit-alpha (see paper)
31% identity, 95% coverage: 12:666/693 of query aligns to 13:691/719 of 6tnmA
- active site: A68 (= A66), F73 (= F71), G116 (= G105), E119 (= E108), P138 (= P127), E139 (= E128), G147 (= G136), N271 (≠ K257), S429 (= S416), H450 (= H437), E462 (= E449), N500 (= N487)
- binding adenosine-5'-triphosphate: D343 (≠ E330), I344 (≠ T331), V400 (= V387), V401 (≠ Y388), V406 (= V393), K584 (= K559)
1wdmA Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form i (native3) (see paper)
31% identity, 93% coverage: 46:689/693 of query aligns to 49:705/707 of 1wdmA
- active site: A69 (= A66), N89 (≠ A86), N93 (≠ S90), G117 (= G105), E120 (= E108), P139 (= P127), E140 (= E128), P147 (= P135), G148 (= G136), S430 (= S416), H451 (= H437), E463 (= E449), N501 (= N487)
- binding acetyl coenzyme *a: K142 (≠ N130), D297 (≠ S282), M459 (= M445), N501 (= N487), P534 (= P520), Y652 (≠ N635), L658 (≠ V641)
- binding nicotinamide-adenine-dinucleotide: G321 (= G307), A322 (= A308), I324 (≠ T310), M325 (= M311), D344 (≠ E330), V401 (= V387), E403 (= E389), N428 (= N414), S430 (= S416), N454 (≠ S440)
7o4uA Structure of the alpha subunit of mycobacterium tuberculosis beta- oxidation trifunctional enzyme in complex with oxidized nicotinamide adenine dinucleotide (see paper)
31% identity, 91% coverage: 16:649/693 of query aligns to 13:673/711 of 7o4uA
Query Sequence
>RR42_RS35270 FitnessBrowser__Cup4G11:RR42_RS35270
MSAINAVADLAVEGEIAILTLNSPPVNALSAAVRAGILAGIERAIADSNVRGIVLTCAGK
TFIAGADITEFGKPPVGPSLADVQAAIEGSPKPVVAAIHGTALGGGLEVALVCHYRVAAR
SARCGLPEVNLGLLPGAGGTQRLPRIVGPAKALDMVTSGAHIGAAAAAEMGLFDLVTEDA
ALRASAIAFARQVNAEQRPLRKVRDLNEKVEAARGKPELFADFRRANARKFRGFDAPEYN
IRCIEAAVNLPFDEGMKVERKLFLELMNGTQSAAQRYYFFASRQVWNVPDVPADTPVIDV
KKVGIIGAGTMGGGIAMNMLNAGIPVVIVETAQQALDRGVRTIRANYDNTAKKGRITAAD
VDRRMALLTPTLELGQLADADLVIEAVYENMDVKKDIFGKLDKIVKPGAILATNTSALDV
NEIARATSRPESVIGLHFFSPANVMKLLEVVRGDKTAKPVIRTSMELARKIGKIAALVGV
CPGFVGNRMLAQRQREAQKLVLEGALPWDIDRVLYNFGFPMGPFAMSDLAGLDLGWIREK
SSSATLREILCEMDRRGQKTGAGYYDYDEKRNAIPSPVVEGIIRDFAARQGKTSRVVCEQ
EILERCIYPMINEGAKILEEGKAIRASDIDVVWVNGYGWPVYRGGPMCYADTIGLDKVLA
VMKNFEATLGADFKPARLLEDLVAQGKKFSDLK
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory