Comparing RR42_RS36245 FitnessBrowser__Cup4G11:RR42_RS36245 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P39120 Citrate synthase 2; Citrate synthase II; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
29% identity, 81% coverage: 72:389/392 of query aligns to 9:360/372 of P39120
8gi7A C143a variant of citrate synthase (cita) in mycobacterium tuberculosis (see paper)
40% identity, 45% coverage: 217:391/392 of query aligns to 168:354/368 of 8gi7A
8gmiA Citrate synthase (cita) in mycobacterium tuberculosis modified by ebselen at c143 residue (see paper)
40% identity, 45% coverage: 217:391/392 of query aligns to 170:356/369 of 8gmiA
Sites not aligning to the query:
8glbD Selenomethionine derivatized citrate synthase (cita) in mycobacterium tuberculosis with pyruvate (see paper)
40% identity, 45% coverage: 217:391/392 of query aligns to 171:357/374 of 8glbD
Sites not aligning to the query:
6abxA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with citrate (see paper)
34% identity, 45% coverage: 211:388/392 of query aligns to 168:358/370 of 6abxA
6abyA Crystal structure of citrate synthase (msed_1522) from metallosphaera sedula in complex with oxaloacetate (see paper)
34% identity, 45% coverage: 211:388/392 of query aligns to 168:358/372 of 6abyA
P39119 Citrate synthase 1; Citrate synthase I; EC 2.3.3.16 from Bacillus subtilis (strain 168) (see paper)
25% identity, 82% coverage: 72:391/392 of query aligns to 8:361/366 of P39119
2c6xA Structure of bacillus subtilis citrate synthase
25% identity, 82% coverage: 72:391/392 of query aligns to 7:360/363 of 2c6xA
1ixeA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
35% identity, 46% coverage: 207:388/392 of query aligns to 167:359/371 of 1ixeA
1iomA Crystal structure of citrate synthase from thermus thermophilus hb8 (see paper)
34% identity, 49% coverage: 198:388/392 of query aligns to 158:362/374 of 1iomA
O34002 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Antarctic bacterium DS2-3R (see 2 papers)
31% identity, 47% coverage: 207:390/392 of query aligns to 172:374/379 of O34002
Sites not aligning to the query:
1a59A Cold-active citrate synthase (see paper)
31% identity, 47% coverage: 207:390/392 of query aligns to 170:372/377 of 1a59A
P9WPD5 Citrate synthase 1; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
33% identity, 48% coverage: 199:388/392 of query aligns to 209:419/431 of P9WPD5
6abwA Crystal structure of citrate synthase (msed_0281) from metallosphaera sedula in complex with acetyl-coa (see paper)
33% identity, 47% coverage: 206:389/392 of query aligns to 159:358/369 of 6abwA
I6Y9Q3 2-methylcitrate synthase; 2-MCS; MCS; Citrate synthase; EC 2.3.3.5; EC 2.3.3.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
33% identity, 44% coverage: 215:388/392 of query aligns to 200:383/393 of I6Y9Q3
Sites not aligning to the query:
6s87D Crystal structure of 2-methylcitrate synthase (prpc) from pseudomonas aeruginosa in complex with oxaloacetate.
30% identity, 45% coverage: 211:388/392 of query aligns to 166:353/365 of 6s87D
2ifcC The structure of the binary complex of oxalateacetate with citrate synthase from the thermophilic archaeon thermolasma acidophilum
29% identity, 58% coverage: 161:389/392 of query aligns to 112:370/382 of 2ifcC
4yboB Structure of citrate synthase from the thermoacidophilic euryarchaeon thermolasma acidophilum (see paper)
29% identity, 58% coverage: 161:389/392 of query aligns to 111:369/381 of 4yboB
2r9eA The structure of the binary complex of citryl dethia coa and citrate synthase from the thermophilic archaeonthermoplasma acidophilum
29% identity, 58% coverage: 161:389/392 of query aligns to 112:370/381 of 2r9eA
2r26A The structure of the ternary complex of carboxymethyl coenzyme a and oxalateacetate with citrate synthase from the thermophilic archaeonthermoplasma acidophilum
29% identity, 58% coverage: 161:389/392 of query aligns to 112:370/381 of 2r26A
>RR42_RS36245 FitnessBrowser__Cup4G11:RR42_RS36245
MPRYLTSSEAAAQLGVSRQTLYAYVSRGLLHAHDGETHRESRYLADDVARLAGQRTRGRK
PREVAKATLSWGLPVLESGITLIEDGRLYYRGMDAVALAASDTVEAVAALLWQCPQDAAF
GAAPLAPAHLAAMQAAFSGRRSEEALLPLFTIASEDDPTAQWQRSPERLAEGCGALVRLL
AACLLHTAPASAPVHRQCASAWQVDEEGADLIRMALVLCADHELNASSFTSRCVASTGAS
LRASVVAGLAALTGGLHGGTTARVEALWDELGEAQPASKLRERLARGENLPGFGHHLYPA
GDIRAAGLLARILPHHPQWQAFIDDAFALVGQRPSIDFALVALRRHLRLPPGAAFGMFAL
GRSIGWIAHALEQRADAELIRPRAAYVGPRPG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory