Comparing RR42_RS36320 FitnessBrowser__Cup4G11:RR42_RS36320 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4ubvA Structure of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis with an partially acetylated cysteine in complex with acetyl-coa and coa (see paper)
41% identity, 100% coverage: 1:392/392 of query aligns to 1:391/391 of 4ubvA
I6XHI4 Steroid 3-ketoacyl-CoA thiolase; Acetyl-CoA acetyltransferase FadA5; Beta-ketoacyl-CoA thiolase; EC 2.3.1.16 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
41% identity, 100% coverage: 1:392/392 of query aligns to 1:391/391 of I6XHI4
4ubtA Structure of the c93s variant of the 3-ketoacyl-coa thiolase fada5 from m. Tuberculosis in complex with a steroid and coa. (see paper)
41% identity, 100% coverage: 1:392/392 of query aligns to 6:396/396 of 4ubtA
2d3tC Fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form v (see paper)
40% identity, 99% coverage: 3:392/392 of query aligns to 6:390/390 of 2d3tC
8oqlC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-1
40% identity, 99% coverage: 3:392/392 of query aligns to 3:397/397 of 8oqlC
8opyD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-b-dnq
40% identity, 99% coverage: 3:392/392 of query aligns to 4:401/401 of 8opyD
8oqoC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-49
40% identity, 99% coverage: 3:392/392 of query aligns to 3:398/398 of 8oqoC
P14611 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
41% identity, 100% coverage: 1:391/392 of query aligns to 1:392/393 of P14611
8oqmD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-10
40% identity, 99% coverage: 3:392/392 of query aligns to 4:399/399 of 8oqmD
8opxC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with trehalose (fragment-b-tre)
40% identity, 99% coverage: 3:392/392 of query aligns to 3:398/398 of 8opxC
8opuC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with sulfamethoxazole (fragment-b-e1)
40% identity, 99% coverage: 3:392/392 of query aligns to 3:399/399 of 8opuC
7o4tD Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme with coenzyme a bound at the hydratase, thiolase active sites and possible additional binding site (coa(ech/had)) (see paper)
40% identity, 99% coverage: 3:392/392 of query aligns to 4:403/403 of 7o4tD
O53871 Putative acyltransferase Rv0859; EC 2.3.1.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
40% identity, 99% coverage: 3:392/392 of query aligns to 4:403/403 of O53871
8pf8C Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-72
40% identity, 99% coverage: 3:392/392 of query aligns to 3:402/402 of 8pf8C
8oqsC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-83
40% identity, 99% coverage: 3:392/392 of query aligns to 3:402/402 of 8oqsC
8oqpC Structure of mycobacterium tuberculosis beta-oxidation trifunctional enzyme in complex with fragment-m-76
40% identity, 99% coverage: 3:392/392 of query aligns to 3:402/402 of 8oqpC
4b3iC Crystal structure of mycobacterium tuberculosis fatty acid beta-oxidation complex with coenzymea bound at the hydratase active sites (see paper)
40% identity, 99% coverage: 3:392/392 of query aligns to 3:402/402 of 4b3iC
4o9cC Crystal structure of beta-ketothiolase (phaa) from ralstonia eutropha h16 (see paper)
40% identity, 100% coverage: 1:391/392 of query aligns to 1:392/393 of 4o9cC
P07097 Acetyl-CoA acetyltransferase; Acetoacetyl-CoA thiolase; Beta-ketothiolase; EC 2.3.1.9 from Shinella zoogloeoides (Crabtreella saccharophila) (see 2 papers)
37% identity, 99% coverage: 4:392/392 of query aligns to 5:392/392 of P07097
2vu1A Biosynthetic thiolase from z. Ramigera. Complex of with o-pantheteine- 11-pivalate. (see paper)
38% identity, 99% coverage: 6:392/392 of query aligns to 6:391/391 of 2vu1A
>RR42_RS36320 FitnessBrowser__Cup4G11:RR42_RS36320
MAEAYIVAAARTAGGRKGGKLAGWHPADLAAQVLNALVARSGADPALIDDVIMGCVGQAG
EQAGNVARNAVLASKLPQSVPGTSVDRQCGSSQQALHFAAQAVMSGTMDIVIAAGVESMT
RVPMGLPSTLPFKNGFGSSMSPAMQERYPGVKFSQFTGAEMMSRKYGLTRDDLDRYALES
HRRAIAATQAGRFKDEIVPVAVRAADGSANGELHTVDEGIRFEASLESISSVKLIEEGGT
VTAASASQICDGAAGLMVVNEAGLKKLGVKPLARIHHMSVLGHDPVIMLEAPLPATLRAL
DKAGMKIGDIDLFEINEAFAPVPLAWLQTTGADPARMNVNGGAIALGHPLGGSGAKLMTT
LVHALHAQGKRYGLQTMCEGGGMANVTIVERL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory