Comparing RR42_RS36370 FitnessBrowser__Cup4G11:RR42_RS36370 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3na8A Crystal structure of a putative dihydrodipicolinate synthetase from pseudomonas aeruginosa
29% identity, 90% coverage: 5:280/308 of query aligns to 2:273/291 of 3na8A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 4ptnA
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 4onvA
4oe7D Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 4oe7D
4oe7B Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 4oe7B
4oe7A Crystal structure of yage, a kdg aldolase protein, in complex with aldol condensed product of pyruvate and glyoxal
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 4oe7A
3nevA Crystal structure of yage, a prophage protein from e. Coli k12 in complex with kdgal (see paper)
30% identity, 88% coverage: 8:279/308 of query aligns to 3:280/298 of 3nevA
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
33% identity, 78% coverage: 8:248/308 of query aligns to 2:248/307 of 5c55A
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
31% identity, 86% coverage: 11:275/308 of query aligns to 8:273/295 of 5ktlA
2atsA Dihydrodipicolinate synthase co-crystallised with (s)-lysine
31% identity, 79% coverage: 38:279/308 of query aligns to 32:274/292 of 2atsA
P0A6L2 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Escherichia coli (strain K12) (see 7 papers)
31% identity, 79% coverage: 38:279/308 of query aligns to 32:274/292 of P0A6L2
5t25A Kinetic, spectral and structural characterization of the slow binding inhibitor acetopyruvate with dihydrodipicolinate synthase from escherichia coli.
31% identity, 79% coverage: 38:279/308 of query aligns to 33:275/293 of 5t25A
4pfmA Shewanella benthica dhdps with lysine and pyruvate
31% identity, 71% coverage: 9:226/308 of query aligns to 4:217/295 of 4pfmA
3i7sA Dihydrodipicolinate synthase mutant - k161a - with the substrate pyruvate bound in the active site. (see paper)
31% identity, 79% coverage: 38:279/308 of query aligns to 32:274/292 of 3i7sA
Sites not aligning to the query:
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
34% identity, 80% coverage: 8:252/308 of query aligns to 2:249/292 of Q07607
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
28% identity, 91% coverage: 11:291/308 of query aligns to 10:290/307 of 4fhaA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
32% identity, 77% coverage: 8:245/308 of query aligns to 2:240/294 of Q8UGL3
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
32% identity, 68% coverage: 9:218/308 of query aligns to 3:212/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
32% identity, 68% coverage: 9:218/308 of query aligns to 3:212/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
32% identity, 68% coverage: 9:218/308 of query aligns to 3:212/291 of 3tdfA
>RR42_RS36370 FitnessBrowser__Cup4G11:RR42_RS36370
MSRNAIHWSGVFPAVSTQFKADYSLDIEATHKVMCNLVADGVCGLVVCGTVGENTSMSAR
EKLAVIEAAKDAARGRVPVIAGIAEFTTAFARDMVTEAARAGVDGVMVMPALVYSAKPHE
AAAHFRDIATATDLPVMLYNNPPVYRSDITPDILVSLADCENIVCFKDSSGDTRRFIDLR
NAVGDRFVLFAGLDDVVLESIAVGADGWISGMSNAFPKEGETLFRLARQRRFDEALALYR
WFMPLLHLDARPDLVQCIKLCEELTGRGSAVTRPPRMPLQGEALAQVMTVVAQAMATRPA
LPDVGLRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory