SitesBLAST
Comparing RR42_RS36375 FitnessBrowser__Cup4G11:RR42_RS36375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5oqtA Crystal structure of a bacterial cationic amino acid transporter (cat) homologue (see paper)
28% identity, 79% coverage: 33:445/524 of query aligns to 51:451/456 of 5oqtA
Sites not aligning to the query:
6f34A Crystal structure of a bacterial cationic amino acid transporter (cat) homologue bound to arginine. (see paper)
28% identity, 79% coverage: 33:445/524 of query aligns to 53:453/458 of 6f34A
- binding arginine: E115 (≠ A99), Y116 (≠ F100), A119 (= A110), F228 (= F211), A229 (= A212), I231 (≠ L214), V314 (≠ T306)
- binding cholesterol: W201 (≠ T180), Y202 (≠ H181)
- binding : A178 (= A157), R179 (= R158), A186 (≠ V165), I187 (≠ F166), A190 (≠ V169), L194 (= L173), Q296 (≠ V288), V299 (≠ L291)
Sites not aligning to the query:
P30825 High affinity cationic amino acid transporter 1; CAT-1; CAT1; Ecotropic retroviral leukemia receptor homolog; Ecotropic retrovirus receptor homolog; Solute carrier family 7 member 1; System Y+ basic amino acid transporter from Homo sapiens (Human) (see paper)
25% identity, 74% coverage: 2:388/524 of query aligns to 22:431/629 of P30825
- N226 (vs. gap) modified: carbohydrate, N-linked (GlcNAc...) asparagine
P25737 Lysine-specific permease LysP; Lysine transporter LysP; Trigger transporter LysP from Escherichia coli (strain K12) (see 2 papers)
28% identity, 65% coverage: 9:348/524 of query aligns to 14:352/489 of P25737
- Y102 (≠ T96) mutation to L: Retains 4% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- W106 (≠ F100) mutation to L: Retains 20% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- K163 (= K167) mutation to A: Retains 24% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- F216 (= F211) mutation to L: Retains 13% of wild-type lysine uptake activity. Increases the capacity to inhibit CadC in the presence of lysine.
- E222 (≠ T217) mutation to A: Abolishes lysine uptake. Strongly inhibits CadC.
- E230 (= E225) mutation to V: Abolishes lysine uptake. Shows significant less inhibition of CadC.
- D275 (≠ G270) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-278.
- D278 (≠ Q273) Essential for the stimulus-dependent interaction with CadC; mutation to A: Retains 88% of wild-type lysine uptake activity, but can hardly inhibit CadC. Cannot interact with CadC; when associated with A-275.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 438 E→A: Retains 14% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 443 D→A: Retains 11% of wild-type lysine uptake activity. Is unable to inhibit CadC.
- 446 D→A: Retains 13% of wild-type lysine uptake activity. Is unable to inhibit CadC.
P82251 b(0,+)-type amino acid transporter 1; b(0,+)AT1; Glycoprotein-associated amino acid transporter b0,+AT1; Solute carrier family 7 member 9 from Homo sapiens (Human) (see 11 papers)
25% identity, 76% coverage: 2:400/524 of query aligns to 20:409/487 of P82251
- V40 (≠ L22) to M: in CSNU; uncertain significance
- IIGSG 43:47 (≠ IFGSG 25:29) binding
- I44 (≠ F26) to T: in CSNU; type I; dbSNP:rs121908485
- S51 (≠ A33) to F: in CSNU; uncertain significance
- P52 (≠ A34) to L: in CSNU; impairs protein stability and dimer formation; dbSNP:rs1198613438
- A70 (≠ L50) to V: in CSNU; partial loss of amino acid transport activity; dbSNP:rs769448665
- Y99 (= Y79) to H: in CSNU; uncertain significance
- G105 (= G85) to R: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908480
- W114 (≠ L94) to R: in CSNU; uncertain significance
- I120 (≠ F100) to L: in CSNU; uncertain significance
- T123 (≠ S102) to M: in CSNU; partial loss of amino acid transport activity; dbSNP:rs79987078
- V142 (≠ S123) to A: no effect on amino acid transport activity; dbSNP:rs12150889
- C144 (≠ S127) modified: Interchain (with C-114 in SLC3A1)
- V170 (= V153) to M: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs121908479
- A182 (≠ V165) to T: in CSNU; type III; partial loss of amino acid transport activity; dbSNP:rs79389353
- G195 (vs. gap) to R: in CSNU; type III; decreased amino acid transport activity; dbSNP:rs121908482
- L223 (≠ I209) to M: slightly decreased amino acid transport activity; dbSNP:rs1007160
- A224 (≠ I210) to V: in CSNU; non-classic type I; dbSNP:rs140873167
- N227 (vs. gap) to D: in CSNU; decreased amino acid transport activity
- W230 (vs. gap) to R: in CSNU; complete loss of amino acid transport activity; mutation to A: Abolishes amino acid transport activity.
- D233 (≠ L214) binding ; mutation to A: Complete loss of amino acid transport activity.
- W235 (≠ L216) mutation to A: Complete loss of amino acid transport activity.
- Q237 (≠ P218) mutation to A: Reduces amino acid transport activity.
- G259 (≠ S240) to R: in CSNU; type III; impairs protein stability and dimer formation; dbSNP:rs121908483
- P261 (≠ L242) to L: in CSNU; types I and III; dbSNP:rs121908486
- S286 (≠ D266) to F: in CSNU; uncertain significance; dbSNP:rs755135545
- C321 (≠ M311) mutation to S: Does not affect amino acid transport activity.
- A324 (≠ T314) to E: in CSNU; uncertain significance
- V330 (≠ G320) to M: in CSNU; type III; dbSNP:rs201618022
- A331 (≠ W321) to V: in CSNU; non-classic type I; dbSNP:rs768466784
- R333 (= R323) to Q: in CSNU; decreased amino acid transport activity; dbSNP:rs769576205; to W: in CSNU; severe loss of amino acid transport activity; dbSNP:rs121908484
- A354 (= A344) to T: in CSNU; type III; severe loss of amino acid transport activity; dbSNP:rs939028046
- S379 (= S370) mutation to A: Markedly reduces amino acid transport activity.
- A382 (≠ L373) to T: in CSNU; severe loss of amino acid transport activity; dbSNP:rs774878350
- W383 (≠ V374) mutation to A: Complete loss of amino acid transport activity.
- Y386 (= Y377) mutation to A: Loss of amino acid transport activity.
- K401 (≠ P392) to E: in CSNU; uncertain significance; dbSNP:rs760264924
Sites not aligning to the query:
- 426 L → P: in CSNU; uncertain significance
- 482 P → L: in CSNU; severe loss of amino acid transport activity; no effect on localization to the apical membrane; dbSNP:rs146815072; mutation P->A,G,S,V: No effect on amino acid transport activity.; mutation P->F,I,M,W: Decreased amino acid transport activity.
6li9B Heteromeric amino acid transporter b0,+at-rbat complex bound with arginine (see paper)
26% identity, 72% coverage: 22:400/524 of query aligns to 11:380/458 of 6li9B
7nf6B Ovine b0,+at-rbat heterodimer (see paper)
26% identity, 74% coverage: 11:400/524 of query aligns to 1:381/455 of 7nf6B
7dsqB Overall structure of the lat1-4f2hc bound with 3,5-diiodo-l-tyrosine (see paper)
26% identity, 80% coverage: 9:425/524 of query aligns to 4:411/464 of 7dsqB
7dsnB Overall structure of the lat1-4f2hc bound with jx-119 (see paper)
26% identity, 80% coverage: 9:425/524 of query aligns to 4:411/464 of 7dsnB
- binding (2~{S})-2-azanyl-7-[[2-(1,3-benzoxazol-2-yl)phenyl]methoxy]-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ A24), I20 (= I25), G22 (= G27), S23 (= S28), G24 (= G29), I97 (≠ F100), I104 (≠ A105), F209 (= F211), A210 (= A212), G212 (≠ L214), I354 (= I366), N361 (≠ L373)
- binding cholesterol hemisuccinate: F109 (≠ A110), Y145 (= Y151), K148 (= K154), V153 (≠ A159), Q326 (≠ A337)
Sites not aligning to the query:
7dslB Overall structure of the lat1-4f2hc bound with jx-078 (see paper)
26% identity, 80% coverage: 9:425/524 of query aligns to 4:411/464 of 7dslB
7dskB Overall structure of the lat1-4f2hc bound with jx-075 (see paper)
26% identity, 80% coverage: 9:425/524 of query aligns to 4:411/464 of 7dskB
- binding (2~{S})-2-azanyl-7-(naphthalen-1-ylmethoxy)-3,4-dihydro-1~{H}-naphthalene-2-carboxylic acid: T19 (≠ A24), I20 (= I25), S23 (= S28), G24 (= G29), I97 (≠ F100), S100 (= S101), S101 (= S102), F209 (= F211), G212 (≠ L214), Y216 (≠ P218), V353 (≠ M365), I354 (= I366), N361 (≠ L373)
- binding cholesterol hemisuccinate: K148 (= K154), A149 (≠ T155), V153 (≠ A159), F157 (≠ V163), H324 (≠ D335)
Sites not aligning to the query:
Q01650 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; CD98 light chain; Integral membrane protein E16; E16; L-type amino acid transporter 1; hLAT1; Solute carrier family 7 member 5; y+ system cationic amino acid transporter from Homo sapiens (Human) (see 3 papers)
26% identity, 80% coverage: 9:425/524 of query aligns to 47:454/507 of Q01650
- Y117 (≠ I77) mutation to A: Strongly decreased leucine transport activity.
- C164 (≠ L122) modified: Interchain (with C-210 in SLC3A2)
- D223 (≠ N186) to V: in dbSNP:rs17853937
- N230 (vs. gap) to K: in dbSNP:rs1060250
- A246 (vs. gap) mutation to V: Nearly abolishes leucine transport activity.
- F252 (= F211) mutation to A: Nearly abolishes leucine transport activity.
- W257 (≠ L216) mutation to A: Nearly abolishes leucine transport activity.
- N258 (≠ T217) mutation to A: Decreased leucine transport activity.; mutation to D: Nearly abolishes leucine transport activity.
- Y259 (≠ P218) mutation to A: Strongly decreased leucine transport activity.
- E303 (= E262) mutation to K: Decreased leucine transport activity.
- P375 (= P343) mutation to L: Nearly abolishes leucine transport activity.
Sites not aligning to the query:
- 483:507 mutation Missing: Nearly abolishes leucine transport activity.
Q9UHI5 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; hLAT2; Solute carrier family 7 member 8 from Homo sapiens (Human) (see 3 papers)
25% identity, 75% coverage: 9:403/524 of query aligns to 37:425/535 of Q9UHI5
- I53 (= I25) binding
- Y93 (= Y63) mutation to A: Nearly complete reduction of glycine, L-alanine, and L-glutamine uptake. Minimal effect on the transport of L-isoleucine, L-histidine and L-tryptophan.
- N134 (≠ L103) Important for substrate specificity; binding ; mutation to Q: Reduces L-leucine uptake activity. Abolishes L-tryptophan uptake.; mutation to S: The substrate specificity changed dramatically reducing L-glutamine, glycine and L-alanine uptake activity thus mimicking the selectivity of SLC7A5.
- C154 (≠ L122) modified: Interchain (with C-210 in SLC3A2)
- W174 (≠ L142) mutation to A: Does not affect protein expression, plasma membrane localization, or L-alanine uptake.
- F243 (= F211) mutation to A: Abolishes leucine and tryptophan transport activities.
- G246 (≠ L214) Important for substrate specificity; binding ; mutation to S: Strong decrease in the uptake of large substrates L-tryptophan, L-glutamine, and L-histidine but increases the uptake of small neutral amino acids glycine and L-alanine.
- V302 (≠ F275) to I: found in a patient with age-related hearing loss; does not affect L-alanine transport activity. Decreases L-tyrosine transport activity
- N395 (≠ L373) binding ; mutation to Q: Strongly reduces L-leucine uptake activity. Strongly reduces L-tryptophan uptake activity.
- Y396 (≠ V374) mutation to A: Strongly reduces L-leucine uptake activity.
- T402 (≠ A380) to M: found in a patient with age-related hearing loss; strongly decreased L-alanine transport activity. Decreases L-tyrosine transport activity
- R418 (= R396) to C: found in a patient with age-related hearing loss; decreases L-alanine transport activity. Decreases L-tyrosine transport activity
Sites not aligning to the query:
- 460 V → E: found in a patient with age-related hearing loss; strongly decreases L-alanine transport activity. Decreases L-tyrosine transport activity. Decreases cell membrane localization
Q7YQK4 Large neutral amino acids transporter small subunit 1; 4F2 light chain; 4F2 LC; 4F2LC; L-type amino acid transporter 1; LAT1; Solute carrier family 7 member 5 from Oryctolagus cuniculus (Rabbit) (see 2 papers)
26% identity, 78% coverage: 9:416/524 of query aligns to 43:440/503 of Q7YQK4
- C88 (≠ G52) mutation to S: No significant effect on inhibition by HgCl(2). Decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-183.
- C98 (≠ V62) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Slightly less decreased KM and Vmax for Phe; when associated with S-183.
- C160 (≠ L122) mutation to S: No change to KM or Vmax for Phe.
- C172 (≠ G134) mutation to S: No change to KM or Vmax for Phe.
- C174 (≠ A136) mutation to S: No change to KM or Vmax for Phe.
- C183 (≠ Y150) mutation to S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe. Similar affect on KM and Vmax for Phe; when associated with S-88. Slightly less decreased KM and Vmax for Phe; when associated with S-98.
- G219 (≠ N186) mutation to D: Decreased KM and Vmax for Trp. Increased KM and Vmax for Phe; when associated with L-234.
- W234 (≠ A202) mutation to L: Decreased KM and Vmax for Trp. Increased KM but decreased Vmax for Phe. Increased KM and Vmax for Phe; when associated with D-219.
- C331 (≠ P303) mutation to S: No significant effect on inhibition by HgCl(2). Increased KM and Vmax for Phe.
- C377 (≠ F349) mutation to S: No significant effect on inhibition by HgCl(2).
- C403 (≠ S376) mutation to S: No significant effect on inhibition by HgCl(2).
- C439 (≠ A415) mutation to S: Prevents insertion into the plasma membrane and possibly protein folding.
Sites not aligning to the query:
- 454 C→S: No significant effect on inhibition by HgCl(2). Slightly increased KM but slightly decreased Vmax for Phe.
- 492 C→S: No significant effect on inhibition by HgCl(2). Slightly decreased KM and Vmax for Phe.
6irtB Human lat1-4f2hc complex bound with bch (see paper)
26% identity, 77% coverage: 22:425/524 of query aligns to 10:404/457 of 6irtB
6f2wA Bacterial asc transporter crystal structure in open to in conformation (see paper)
23% identity, 83% coverage: 9:445/524 of query aligns to 2:429/433 of 6f2wA
Q9QXW9 Large neutral amino acids transporter small subunit 2; L-type amino acid transporter 2; mLAT2; Solute carrier family 7 member 8 from Mus musculus (Mouse) (see paper)
25% identity, 75% coverage: 9:403/524 of query aligns to 36:424/531 of Q9QXW9
- Y130 (≠ F100) mutation to A: Increases T2 import. Increases T3 and enables T4 import. Does not affect L-leucine and L-phenylalanine uptake.
- N133 (≠ L103) mutation to S: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake. Increases the export of both L-leucine and L-phenylalanine.
- F242 (= F211) mutation to W: Increases T2 import. Does not affect T3 import. Does not affect L-leucine and L-phenylalanine uptake.
7b00A Human lat2-4f2hc complex in the apo-state (see paper)
25% identity, 73% coverage: 22:403/524 of query aligns to 10:385/457 of 7b00A
Sites not aligning to the query:
7cmiB The lat2-4f2hc complex in complex with leucine (see paper)
25% identity, 73% coverage: 22:403/524 of query aligns to 10:385/458 of 7cmiB
7cmhB The lat2-4f2hc complex in complex with tryptophan (see paper)
25% identity, 73% coverage: 22:403/524 of query aligns to 10:385/458 of 7cmhB
Query Sequence
>RR42_RS36375 FitnessBrowser__Cup4G11:RR42_RS36375
MSPVQGKFKRQLSLTDLTFIGLGAIFGSGWLFAASHVSAIAGPAGIISWLLGGFAVLLLG
IVYCELGAALPRAGGIIRYPVFSHGELMGYLMGLITLIAFSSLIAIEVVAARQYAAAWFP
FLSQPGSSNPTLPGWALQFAMLCLFFVLNYYSVKTFARANNIVSVFKFVVPLLVIVVLFT
HFKPANLQVHGFAPFGLSGIQAAVSAGGIIFAYLGLTPIISVASEVRSPQRTIPIALILS
VLLSTLIYVLLQIAFLGGVPTETLSDGWRGVGQAFALPYRDIALALGVGWLAFLVVSDAV
ISPSGTGNIYMNATPRVVYGWARGGTFFKSFSRIDAASGIPRPALWLTFALSVFWTLPFP
SWEAMINVVSAALVLSYAVAPVTVAALRRNAPSLHRPFRVRWLAVLGPLSFIIAALIVYW
SGWGTVSWLLGLQIAMFVVYLLCRRAVPTHRLSLAQQVKSSLWLIAFYLLIIVASYLGTF
GGIGAISHPWDTGLVALIALGIYGWGARTGIPAALLDLGGDDDE
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory