SitesBLAST
Comparing RR42_RS36390 FitnessBrowser__Cup4G11:RR42_RS36390 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6wy8C Tcur3481-tcur3483 steroid acad (see paper)
33% identity, 99% coverage: 1:376/381 of query aligns to 1:358/364 of 6wy8C
6fahD Molecular basis of the flavin-based electron-bifurcating caffeyl-coa reductase reaction (see paper)
29% identity, 95% coverage: 5:366/381 of query aligns to 3:366/379 of 6fahD
- active site: L124 (≠ H125), T125 (≠ A126), G241 (≠ A240)
- binding flavin-adenine dinucleotide: F122 (≠ W123), L124 (≠ H125), T125 (≠ A126), R152 (≠ H153), F155 (≠ V156), T157 (≠ V158), E198 (= E198), R267 (= R266), Q269 (= Q268), F270 (= F269), I274 (= I273), F277 (= F276), Q335 (= Q335), I336 (= I336), G339 (= G339), Y361 (≠ Q361), T364 (≠ S364), Q366 (≠ E366)
Sites not aligning to the query:
6wy9B Tcur3481-tcur3483 steroid acad g363a variant (see paper)
33% identity, 98% coverage: 5:376/381 of query aligns to 2:355/361 of 6wy9B
8sgsA Short-chain specific acyl-CoA dehydrogenase, mitochondrial (see paper)
29% identity, 85% coverage: 51:372/381 of query aligns to 47:380/381 of 8sgsA
- binding coenzyme a: S131 (≠ H135), A133 (≠ V137), N177 (≠ D178), F231 (≠ L230), M235 (≠ E234), L238 (≠ S237), I312 (≠ Q310), E362 (≠ F362), G363 (= G363)
- binding flavin-adenine dinucleotide: F122 (≠ W123), L124 (≠ H125), S125 (≠ A126), G130 (≠ R131), S131 (≠ H135), W155 (≠ V156), T157 (≠ V158), R267 (= R266), F270 (= F269), L274 (≠ I273), L277 (≠ F276), Q335 (= Q335), I336 (= I336), G338 (= G338), G339 (= G339), I357 (≠ A357), I360 (≠ L360), Y361 (≠ Q361), T364 (≠ S364), E366 (= E366)
P16219 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Homo sapiens (Human) (see 3 papers)
29% identity, 85% coverage: 51:372/381 of query aligns to 77:410/412 of P16219
- G90 (= G64) to S: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908005
- E104 (≠ Q78) natural variant: Missing (in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs387906308)
- 152:161 (vs. 123:135, 23% identical) binding in other chain
- R171 (= R143) to W: 69% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1800556
- WIT 185:187 (≠ VVV 156:158) binding in other chain
- A192 (= A163) to V: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940874
- G209 (= G181) to S: 86% of wild-type acyl-CoA dehydrogenase activity; confers susceptibility to ethylmalonicaciduria; dbSNP:rs1799958
- R297 (= R266) binding
- Q308 (= Q277) binding in other chain
- R325 (≠ V294) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs121908006
- S353 (≠ G323) to L: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28941773
- QILGG 365:369 (≠ QIHGG 335:339) binding
- R380 (≠ H350) to W: in ACADSD; loss of acyl-CoA dehydrogenase activity; dbSNP:rs28940875
- TSE 394:396 (≠ SAE 364:366) binding in other chain
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
7y0bA Crystal structure of human short-chain acyl-coa dehydrogenase
29% identity, 85% coverage: 51:372/381 of query aligns to 50:383/385 of 7y0bA
- binding (2S,3R,4R,5S,6R)-2-[4-chloranyl-3-[[4-[(3S)-oxolan-3-yl]oxyphenyl]methyl]phenyl]-6-(hydroxymethyl)oxane-3,4,5-triol: M343 (= M340), T347 (≠ E344), E348 (= E345)
- binding flavin-adenine dinucleotide: F125 (≠ W123), L127 (≠ H125), S128 (≠ A126), G133 (≠ R131), S134 (≠ H135), W158 (≠ V156), T160 (≠ V158), R270 (= R266), F273 (= F269), L280 (≠ F276), V282 (= V278), Q338 (= Q335), I339 (= I336), G342 (= G339), I360 (≠ A357), Y364 (≠ Q361), T367 (≠ S364), E369 (= E366), I370 (vs. gap), L373 (vs. gap)
7y0aC Crystal structure of human short-chain acyl-coa dehydrogenase
29% identity, 85% coverage: 51:372/381 of query aligns to 53:386/387 of 7y0aC
- binding flavin-adenine dinucleotide: F128 (≠ W123), L130 (≠ H125), S131 (≠ A126), G136 (≠ R131), S137 (≠ H135), W161 (≠ V156), T163 (≠ V158), T214 (≠ A207), R273 (= R266), F276 (= F269), L280 (≠ I273), L283 (≠ F276), V285 (= V278), Q341 (= Q335), I342 (= I336), G345 (= G339), I363 (≠ A357), Y367 (≠ Q361), T370 (≠ S364), E372 (= E366), L376 (vs. gap)
P15651 Short-chain specific acyl-CoA dehydrogenase, mitochondrial; SCAD; Butyryl-CoA dehydrogenase; EC 1.3.8.1 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 85% coverage: 50:372/381 of query aligns to 76:410/412 of P15651
Sites not aligning to the query:
- 1:24 modified: transit peptide, Mitochondrion
1jqiA Crystal structure of rat short chain acyl-coa dehydrogenase complexed with acetoacetyl-coa (see paper)
28% identity, 85% coverage: 50:372/381 of query aligns to 49:383/384 of 1jqiA
- active site: G377 (vs. gap)
- binding acetoacetyl-coenzyme a: L95 (≠ V93), F125 (≠ W123), S134 (≠ Y132), F234 (≠ L230), M238 (≠ E234), Q239 (≠ R235), L241 (≠ S237), D242 (= D238), R245 (≠ A241), Y364 (≠ Q361), E365 (≠ F362), G366 (= G363)
- binding flavin-adenine dinucleotide: F125 (≠ W123), L127 (≠ H125), S128 (≠ A126), G133 (≠ R131), S134 (≠ Y132), W158 (≠ V156), T160 (≠ V158), R270 (= R266), F273 (= F269), L280 (≠ F276), Q338 (= Q335), I339 (= I336), G342 (= G339), I360 (≠ A357), T367 (≠ S364), E369 (= E366), I370 (vs. gap)
2vigB Crystal structure of human short-chain acyl coa dehydrogenase
29% identity, 85% coverage: 51:372/381 of query aligns to 44:370/371 of 2vigB
- active site: L121 (≠ H125), S122 (≠ A126), G231 (≠ A240), E352 (≠ F362), G364 (vs. gap)
- binding coenzyme a persulfide: S128 (≠ H135), F221 (≠ L230), M225 (≠ E234), Q226 (≠ R235), L228 (≠ S237), D229 (= D238), R232 (≠ A241), E352 (≠ F362), G353 (= G363), I357 (vs. gap)
- binding flavin-adenine dinucleotide: L121 (≠ H125), S122 (≠ A126), G127 (≠ R131), S128 (≠ H135), W152 (≠ V156), T154 (≠ V158), R257 (= R266), F260 (= F269), L264 (≠ I273), L267 (≠ F276), Q325 (= Q335), I326 (= I336), G329 (= G339), I347 (≠ A357), Y351 (≠ Q361), T354 (≠ S364), E356 (= E366)
1ivhA Structure of human isovaleryl-coa dehydrogenase at 2.6 angstroms resolution: structural basis for substrate specificity (see paper)
26% identity, 95% coverage: 5:366/381 of query aligns to 8:374/387 of 1ivhA
- active site: M130 (≠ H125), S131 (≠ A126), E249 (≠ A240), A370 (≠ F362)
- binding coenzyme a persulfide: S137 (≠ Y132), S185 (= S175), R186 (= R176), V239 (≠ L230), Y240 (≠ T231), M243 (≠ E234), E249 (≠ A240), R250 (≠ A241), G369 (≠ Q361), A370 (≠ F362), G371 (= G363)
- binding flavin-adenine dinucleotide: L128 (≠ W123), M130 (≠ H125), S131 (≠ A126), G136 (≠ R131), S137 (≠ Y132), W161 (≠ V156), T163 (≠ V158), R275 (= R266), F278 (= F269), F285 (= F276), M288 (≠ L279), Q343 (= Q335), C344 (≠ I336), G347 (= G339), T372 (≠ S364), E374 (= E366)
Sites not aligning to the query:
P26440 Isovaleryl-CoA dehydrogenase, mitochondrial; IVD; Butyryl-CoA dehydrogenase; EC 1.3.8.4; EC 1.3.8.1 from Homo sapiens (Human) (see 5 papers)
26% identity, 95% coverage: 5:366/381 of query aligns to 45:411/426 of P26440
- 165:174 (vs. 123:132, 30% identical) binding
- S174 (≠ Y132) binding
- WIT 198:200 (≠ VVV 156:158) binding
- SR 222:223 (= SR 175:176) binding
- G250 (= G204) to A: in IVA; uncertain significance
- Y277 (≠ T231) binding
- DLER 284:287 (≠ DEAA 238:241) binding
- E286 (≠ A240) active site, Proton acceptor; mutation to D: Residual isovaleryl-CoA dehydrogenase activity.; mutation to G: Loss of isovaleryl-CoA dehydrogenase activity. Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 407-E.; mutation to Q: Loss of isovaleryl-CoA dehydrogenase activity.
- A291 (≠ C245) to V: in IVA; uncertain significance; dbSNP:rs886042098
- R312 (= R266) binding
- Q323 (= Q277) binding
- I379 (≠ V334) to T: in IVA; uncertain significance
- QCFGG 380:384 (≠ QIHGG 335:339) binding
- R398 (≠ K353) to Q: in IVA; uncertain significance; dbSNP:rs1477527791
- Y403 (≠ I358) to N: in IVA; uncertain significance
- A407 (≠ F362) mutation to E: Does not affect isovaleryl-CoA dehydrogenase activity; when associated with 286-D.
- AG 407:408 (≠ FG 362:363) binding
- TSE 409:411 (≠ SAE 364:366) binding
Sites not aligning to the query:
- 1:32 modified: transit peptide, Mitochondrion
8sgrA Isovaleryl-CoA dehydrogenase, mitochondrial (see paper)
26% identity, 95% coverage: 5:366/381 of query aligns to 12:378/393 of 8sgrA
- binding flavin-adenine dinucleotide: S135 (≠ A126), G140 (≠ R131), S141 (≠ Y132), W165 (≠ V156), T167 (≠ V158), R279 (= R266), F282 (= F269), I286 (= I273), F289 (= F276), Q347 (= Q335), C348 (≠ I336), G351 (= G339), L369 (≠ A357), G375 (= G363), T376 (≠ S364)
Sites not aligning to the query:
8i4rA Crystal structure of acyl-coa dehydrogenase complexed with acetyl-coa from thermobifida fusca
29% identity, 78% coverage: 60:358/381 of query aligns to 58:363/381 of 8i4rA
- binding acetyl coenzyme *a: S132 (≠ Y132), T134 (≠ L134), R180 (≠ D180), R234 (≠ T231), L237 (≠ E234), R238 (= R235), L240 (≠ S237), D241 (= D238), R244 (≠ A241)
- binding flavin-adenine dinucleotide: Y123 (≠ W123), L125 (≠ H125), S126 (≠ A126), G131 (≠ R131), S132 (≠ Y132), W156 (≠ V156), I157 (≠ V157), T158 (≠ V158), I360 (≠ V355)
Sites not aligning to the query:
8i4pA Crystal structure of acyl-coa dehydrogenase from thermobifida fusca
29% identity, 78% coverage: 60:358/381 of query aligns to 58:363/381 of 8i4pA
Sites not aligning to the query:
7w0jE Acyl-coa dehydrogenase, tfu_1647
29% identity, 78% coverage: 60:358/381 of query aligns to 59:364/382 of 7w0jE
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: S127 (≠ A126), W157 (≠ V156), R270 (= R266), Q272 (= Q268), F273 (= F269), I277 (= I273), F280 (= F276), I283 (≠ L279), Q339 (= Q335), L340 (≠ I336), G343 (= G339)
Sites not aligning to the query:
- binding [[(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2R,3S,4S)-5-azanyl-2,3,4-tris(oxidanyl)pentyl] hydrogen phosphate: 365, 366, 368, 370, 371
4l1fA Electron transferring flavoprotein of acidaminococcus fermentans: towards a mechanism of flavin-based electron bifurcation (see paper)
28% identity, 94% coverage: 1:358/381 of query aligns to 1:361/380 of 4l1fA
- active site: L125 (≠ H125), T126 (≠ A126), G242 (≠ A240)
- binding coenzyme a persulfide: T132 (≠ Y132), H179 (≠ D180), F232 (≠ L230), M236 (≠ E234), E237 (≠ R235), L239 (≠ S237), D240 (= D238), R243 (≠ A241)
- binding flavin-adenine dinucleotide: F123 (≠ W123), L125 (≠ H125), T126 (≠ A126), G131 (≠ R131), T132 (≠ Y132), F156 (≠ V156), I157 (≠ V157), T158 (≠ V158), R268 (= R266), Q270 (= Q268), F271 (= F269), I275 (= I273), F278 (= F276), L281 (= L279), Q336 (= Q335), I337 (= I336), G340 (= G339), I358 (≠ V355)
- binding 1,3-propandiol: L5 (≠ F5), Q10 (≠ S10)
Sites not aligning to the query:
4n5fA Crystal structure of a putative acyl-coa dehydrogenase with bound fadh2 from burkholderia cenocepacia j2315
29% identity, 96% coverage: 1:366/381 of query aligns to 2:368/378 of 4n5fA
- active site: L126 (≠ H125), T127 (≠ A126), G243 (≠ A240), E364 (≠ F362)
- binding dihydroflavine-adenine dinucleotide: L126 (≠ H125), T127 (≠ A126), G132 (≠ R131), S133 (≠ Y132), F157 (≠ V156), T159 (≠ V158), T210 (vs. gap), Y363 (≠ Q361), T366 (≠ S364), E368 (= E366)
Sites not aligning to the query:
5ol2F The electron transferring flavoprotein/butyryl-coa dehydrogenase complex from clostridium difficile (see paper)
26% identity, 83% coverage: 52:366/381 of query aligns to 48:366/378 of 5ol2F
- active site: L124 (≠ H125), T125 (≠ A126), G241 (≠ A240)
- binding coenzyme a persulfide: L238 (≠ S237), R242 (≠ A241), E362 (≠ F362), G363 (= G363)
- binding flavin-adenine dinucleotide: F122 (≠ W123), L124 (≠ H125), T125 (≠ A126), P127 (= P128), T131 (≠ Y132), F155 (≠ V156), I156 (≠ V157), T157 (≠ V158), E198 (≠ Q197), R267 (= R266), F270 (= F269), L274 (≠ I273), F277 (= F276), Q335 (= Q335), L336 (≠ I336), G338 (= G338), G339 (= G339), Y361 (≠ Q361), T364 (≠ S364), E366 (= E366)
Sites not aligning to the query:
7szvA Crystal structure of acyl-coa dehydrogenase from mycobacterium marinum in complex with fda
25% identity, 84% coverage: 50:369/381 of query aligns to 44:363/372 of 7szvA
- binding dihydroflavine-adenine dinucleotide: L122 (≠ H125), T123 (≠ A126), F153 (≠ V156), I154 (≠ V157), T155 (≠ V158), K194 (≠ V202), R261 (= R266), S263 (≠ Q268), Y271 (≠ F276), I274 (≠ L279), Q329 (= Q335), V330 (≠ I336), G332 (= G338), G333 (= G339), T358 (≠ S364), E360 (= E366)
Query Sequence
>RR42_RS36390 FitnessBrowser__Cup4G11:RR42_RS36390
MDFQFSEEQSMLRDTLARYLADHYSFEARQAAIRSPAGWRASCWQALAQELGLLGAAFPE
RFGGLGGNAVEHTIVMEQFGRHLVVEPYLSTVVLGGGALLHGSETLAASWLPAIIGGEAT
VAWAHAEPRSRYCLHDVQASAARAQGGWRLDGHKAVVVAAPWATHLVVSARTGGSRRDRD
GISLFWIARDAPGVTLQEYPTVDGSRAADIRLDNVFVPDGGLLGAEGEALTLIERLSDEA
AVALCAEAGGAMSRMLGDTVDYARQRKQFGVPIATFQVLQHRMADMYVQLEQTVALTQVA
AMQVGAQPTQRALAASAAKAQAGQAGRFVGQAAVQIHGGMGVTEELAVGHYFKRVTAIDL
QFGSAEHHLRRYADLLYPVAA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory