Comparing RR42_RS37415 FitnessBrowser__Cup4G11:RR42_RS37415 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2qflA Structure of suhb: inositol monophosphatase and extragenic suppressor from e. Coli (see paper)
31% identity, 74% coverage: 68:262/265 of query aligns to 68:262/262 of 2qflA
Sites not aligning to the query:
P0ADG4 Nus factor SuhB; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25 from Escherichia coli (strain K12) (see 5 papers)
31% identity, 74% coverage: 68:262/265 of query aligns to 68:262/267 of P0ADG4
Sites not aligning to the query:
6ib8B Structure of a complex of suhb and nusa ar2 domain (see paper)
31% identity, 74% coverage: 68:262/265 of query aligns to 72:266/270 of 6ib8B
6tqoT Rrn anti-termination complex (see paper)
31% identity, 74% coverage: 68:262/265 of query aligns to 60:254/255 of 6tqoT
Sites not aligning to the query:
3lv0A Crystal structure of extragenic suppressor protein suhb from bartonella henselae, native
28% identity, 96% coverage: 10:263/265 of query aligns to 17:256/258 of 3lv0A
3luzA Crystal structure of extragenic suppressor protein suhb from bartonella henselae, via combined iodide sad molecular replacement (see paper)
28% identity, 74% coverage: 67:263/265 of query aligns to 53:238/238 of 3luzA
Sites not aligning to the query:
P20456 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Bos taurus (Bovine) (see paper)
27% identity, 92% coverage: 5:249/265 of query aligns to 9:253/277 of P20456
2bjiA High resolution structure of myo-inositol monophosphatase, the target of lithium therapy (see paper)
27% identity, 92% coverage: 5:249/265 of query aligns to 7:251/274 of 2bjiA
2p3nA Thermotoga maritima impase tm1415 (see paper)
26% identity, 94% coverage: 5:254/265 of query aligns to 4:239/256 of 2p3nA
O33832 Fructose-1,6-bisphosphatase/inositol-1-monophosphatase; FBPase/IMPase; Inositol-1-phosphatase; I-1-Pase; EC 3.1.3.11; EC 3.1.3.25 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
26% identity, 94% coverage: 5:254/265 of query aligns to 4:239/256 of O33832
Q19420 Inositol monophosphatase ttx-7; IMP; IMPase; Abnormal thermotaxis protein 7; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase; EC 3.1.3.25; EC 3.1.3.94 from Caenorhabditis elegans (see paper)
29% identity, 94% coverage: 5:252/265 of query aligns to 14:266/285 of Q19420
1imdA Structural studies of metal binding by inositol monophosphatase: evidence for two-metal ion catalysis (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 32:250/266 of 1imdA
6zk0AAA human impase with ebselen (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 33:251/274 of 6zk0AAA
4as4A Structure of human inositol monophosphatase 1 (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 34:252/274 of 4as4A
P29218 Inositol monophosphatase 1; IMP 1; IMPase 1; D-galactose 1-phosphate phosphatase; Inositol-1(or 4)-monophosphatase 1; Lithium-sensitive myo-inositol monophosphatase A1; EC 3.1.3.25; EC 3.1.3.94 from Homo sapiens (Human) (see 5 papers)
27% identity, 85% coverage: 25:250/265 of query aligns to 36:254/277 of P29218
6giuA Human impase with l-690330 (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 34:252/275 of 6giuA
2hhmA Structure of inositol monophosphatase, the putative target of lithium therapy (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 32:250/272 of 2hhmA
1imbA Structural analysis of inositol monophosphatase complexes with substrates (see paper)
27% identity, 85% coverage: 25:250/265 of query aligns to 32:250/272 of 1imbA
1awbA Human myo-inositol monophosphatase in complex with d-inositol-1- phosphate and calcium
27% identity, 85% coverage: 25:250/265 of query aligns to 32:250/272 of 1awbA
2cziA Crystal structure of human myo-inositol monophosphatase 2 (impa2) with calcium and phosphate ions (see paper)
26% identity, 89% coverage: 16:250/265 of query aligns to 17:242/259 of 2cziA
>RR42_RS37415 FitnessBrowser__Cup4G11:RR42_RS37415
MAAVLDSLSALLAQQGRLLRTQQPRSAPADFQALRAAFEQHSGAVGSTLKRALLERWPQI
PFSDKELESGEQQAPEHADAYWVCDPIDGALHYLSGMPGWTIALCLVVEGVPALALVHDP
ATGRTYRAVAGQGADCDGAPLRANARGELASALITTAHPNWPGQVRNDTAAFLDRFGRLL
PQVFGQRVYGPTSLLLALVAGGALDGYWECGQDYYDWLPGVLLVTEAGGVVTALDGKPFT
WGCQGIVAAGPAMHAGLRSALARQG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory