Comparing SM_b20005 FitnessBrowser__Smeli:SM_b20005 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4hz2B Crystal structure of glutathione s-transferase xaut_3756 (target efi- 507152) from xanthobacter autotrophicus py2
38% identity, 94% coverage: 1:191/203 of query aligns to 2:195/206 of 4hz2B
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
33% identity, 94% coverage: 2:192/203 of query aligns to 4:197/201 of 3m3mA
1pn9A Crystal structure of an insect delta-class glutathione s-transferase from a ddt-resistant strain of the malaria vector anopheles gambiae (see paper)
32% identity, 94% coverage: 1:191/203 of query aligns to 1:193/209 of 1pn9A
Sites not aligning to the query:
3wywB Structural characterization of catalytic site of a nilaparvata lugens delta-class glutathione transferase (see paper)
28% identity, 95% coverage: 1:193/203 of query aligns to 3:197/214 of 3wywB
4pngB Glutathione s-transferase from drosophila melanogaster - isozyme e7 (see paper)
32% identity, 88% coverage: 16:193/203 of query aligns to 19:200/223 of 4pngB
Sites not aligning to the query:
7rkaA Crystal structure analysis of colorado potato beetle glutathione-s transferase ldgstu1 (see paper)
31% identity, 82% coverage: 16:181/203 of query aligns to 17:185/211 of 7rkaA
1r5aA Glutathione s-transferase (see paper)
29% identity, 91% coverage: 3:186/203 of query aligns to 4:188/214 of 1r5aA
Sites not aligning to the query:
3vwxC Structural analysis of an epsilon-class glutathione s-transferase from housefly, musca domestica (see paper)
30% identity, 87% coverage: 17:193/203 of query aligns to 18:198/220 of 3vwxC
Sites not aligning to the query:
4i97A The crystal structure of glutathione s-transferase sniggstd1a from scaptomyza nigrita in complex with glutathione
30% identity, 94% coverage: 3:193/203 of query aligns to 3:195/207 of 4i97A
4gsnB Crystal structure of gste2 zan/u variant from anopheles gambiae (see paper)
33% identity, 94% coverage: 3:193/203 of query aligns to 5:197/220 of 4gsnB
2imkA Structures of an insect epsilon-class glutathione s-transferase from the malaria vector anopheles gambiae: evidence for high ddt- detoxifying activity (see paper)
33% identity, 94% coverage: 3:193/203 of query aligns to 5:197/220 of 2imkA
Sites not aligning to the query:
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
34% identity, 88% coverage: 16:193/203 of query aligns to 18:199/221 of 4pnfB
Sites not aligning to the query:
3ljrA Glutathione transferase (theta class) from human in complex with the glutathione conjugate of 1-menaphthyl sulfate (see paper)
30% identity, 94% coverage: 1:190/203 of query aligns to 3:202/244 of 3ljrA
Sites not aligning to the query:
P0CG30 Glutathione S-transferase theta-2B; Glutathione S-transferase theta-2; GST class-theta-2; EC 2.5.1.18 from Homo sapiens (Human) (see 2 papers)
30% identity, 94% coverage: 1:190/203 of query aligns to 3:202/244 of P0CG30
Sites not aligning to the query:
5zwpA Crystal structure of the delta-class glutathione transferase from musca domestica (see paper)
29% identity, 95% coverage: 1:193/203 of query aligns to 1:195/207 of 5zwpA
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
32% identity, 94% coverage: 3:193/203 of query aligns to 8:200/222 of 3zmkB
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
31% identity, 94% coverage: 1:191/203 of query aligns to 3:202/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
31% identity, 94% coverage: 1:191/203 of query aligns to 1:200/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
31% identity, 94% coverage: 1:191/203 of query aligns to 1:200/212 of O86043
7rhpA Crystal structure of honeybee (apis mellifera) glutathione s- transferase amgstd1 (see paper)
27% identity, 96% coverage: 3:196/203 of query aligns to 10:205/215 of 7rhpA
>SM_b20005 FitnessBrowser__Smeli:SM_b20005
MKLYHHPLSGHAHRARLFLSLLGIEHELVVVDFARREHKQADFLKLNSFGQVPVLDDAGT
IISDSNAILVYLAKKTGRPDWLPEDAVGAAAVQRWLSVAAGQIAHGPAQARLINVFKAPY
RPEEVIPRSHAILALIEQELEGRGWIAADRPTIADVALYSYVARAPEGDVDLQPYPEIRA
WLARIEALPGFVEFEKTPVGLAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory