Comparing SM_b20020 FitnessBrowser__Smeli:SM_b20020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1umdD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
43% identity, 45% coverage: 374:682/692 of query aligns to 3:313/323 of 1umdD
1umcD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
43% identity, 45% coverage: 374:682/692 of query aligns to 3:313/323 of 1umcD
1umbD Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
43% identity, 45% coverage: 374:682/692 of query aligns to 3:313/323 of 1umbD
Q5SLR3 2-oxoisovalerate dehydrogenase subunit beta; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDH E1-beta; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
43% identity, 45% coverage: 374:682/692 of query aligns to 4:314/324 of Q5SLR3
1qs0B Crystal structure of pseudomonas putida 2-oxoisovalerate dehydrogenase (branched-chain alpha-keto acid dehydrogenase, e1b) (see paper)
39% identity, 46% coverage: 374:691/692 of query aligns to 5:337/338 of 1qs0B
3dv0D Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
42% identity, 44% coverage: 373:674/692 of query aligns to 2:307/324 of 3dv0D
3dv0B Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
42% identity, 44% coverage: 373:674/692 of query aligns to 2:307/324 of 3dv0B
3dufD Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
42% identity, 44% coverage: 373:674/692 of query aligns to 2:307/324 of 3dufD
1w85B The crystal structure of pyruvate dehydrogenase e1 bound to the peripheral subunit binding domain of e2 (see paper)
42% identity, 44% coverage: 373:674/692 of query aligns to 2:307/324 of 1w85B
2j9fD Human branched-chain alpha-ketoacid dehydrogenase-decarboxylase e1b (see paper)
37% identity, 43% coverage: 369:667/692 of query aligns to 3:306/329 of 2j9fD
P21953 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial; Branched-chain alpha-keto acid dehydrogenase E1 component beta chain; BCKDE1B; BCKDH E1-beta; EC 1.2.4.4 from Homo sapiens (Human) (see 2 papers)
37% identity, 43% coverage: 369:667/692 of query aligns to 66:369/392 of P21953
1dtwB Human branched-chain alpha-keto acid dehydrogenase (see paper)
38% identity, 43% coverage: 372:667/692 of query aligns to 3:303/326 of 1dtwB
6cerD Human pyruvate dehydrogenase complex e1 component v138m mutation (see paper)
35% identity, 45% coverage: 373:682/692 of query aligns to 4:321/331 of 6cerD
6cfoB Human pyruvate dehydrogenase e1 component complex with covalent tdp adduct acetyl phosphinate (see paper)
35% identity, 45% coverage: 373:682/692 of query aligns to 3:320/330 of 6cfoB
P11177 Pyruvate dehydrogenase E1 component subunit beta, mitochondrial; PDHE1-B; EC 1.2.4.1 from Homo sapiens (Human) (see 6 papers)
35% identity, 45% coverage: 373:682/692 of query aligns to 32:349/359 of P11177
Sites not aligning to the query:
Q5SLR4 2-oxoisovalerate dehydrogenase subunit alpha; Branched-chain alpha-keto acid dehydrogenase E1 component alpha chain; BCKDH E1-alpha; EC 1.2.4.4 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
27% identity, 47% coverage: 21:344/692 of query aligns to 39:351/367 of Q5SLR4
1umdA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate (see paper)
27% identity, 47% coverage: 21:344/692 of query aligns to 34:346/362 of 1umdA
1umcA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methylpentanoate (see paper)
27% identity, 47% coverage: 21:344/692 of query aligns to 34:346/362 of 1umcA
1umbA Branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 in holo-form (see paper)
27% identity, 47% coverage: 21:344/692 of query aligns to 34:346/362 of 1umbA
3dufA Snapshots of catalysis in the e1 subunit of the pyruvate dehydrogenase multi-enzyme complex (see paper)
27% identity, 47% coverage: 21:344/692 of query aligns to 44:347/365 of 3dufA
>SM_b20020 FitnessBrowser__Smeli:SM_b20020
MAQAALKKDRRNAPDESIDWKKVVQLLLLSRALDEMEEQRLVPEKKILYQFSARGHDMAQ
ILLGLHLTGRHDAACGYYRSRPLLLALGVDPADALGSAMGRAGGYSDGRDIGVVFNYPNP
HGASALPMCGGVGTQYTPTAGWAQAITYFSEVLGKEEYQKDIAVVLGGDGSVASNGFWSA
LTIATTQGLPLLFYIEDNGFGISVPSSFQTPEGNIAGNLAGWKNLTVLDGDGSDPEEAAR
LTKGAVELVREGRMPVLLRLEVPRLEGHSFQDTQTYKSEELVRSEWAHDPLPRLRDYIVP
AMLSAEEWNEAARDAKAAAERARVEAESRPVADPETVTSHVFFEGRMQVMGGQHPAGYRP
PKTTETATGDGQRINMVTAIRRTLDHEMTVNQRVVLFGEDIGPKGGVHAVTLGLQEKFGT
ARVFDTSLSEEGIIGRAVGMALAGLVPVPEIQFRKYAEPAIEQLNDCGTIRWRTSNRFAA
PIVVRMAGGFLKCGDPWHSQTNEVAFVHQPGWKIAVPSNAEDAVGLLRTALRGNDPVIFF
EHRAMLDHPWARRPYPGDAFALPFGKAKFTREGRDITIVTWGAMVPRCEEAAEGISADVI
DLRTLMPWDRKAVIASVRRTRRCLIVHEDLATAGFGAEIAAAVADEAFIDLDAPISRLTM
PDIPSPHNPALLDWAVPSTERIRRKIIDLLEF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory