Comparing SM_b20058 FitnessBrowser__Smeli:SM_b20058 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P07821 Iron(3+)-hydroxamate import ATP-binding protein FhuC; Ferric hydroxamate uptake protein C; Ferrichrome transport ATP-binding protein FhuC; Iron(III)-hydroxamate import ATP-binding protein FhuC; EC 7.2.2.16 from Escherichia coli (strain K12) (see 2 papers)
38% identity, 94% coverage: 2:250/266 of query aligns to 11:263/265 of P07821
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
33% identity, 83% coverage: 3:223/266 of query aligns to 2:224/240 of 4ymuJ
3d31A Modbc from methanosarcina acetivorans (see paper)
35% identity, 82% coverage: 18:235/266 of query aligns to 16:231/348 of 3d31A
Sites not aligning to the query:
5x40A Structure of a cbio dimer bound with amppcp (see paper)
37% identity, 83% coverage: 3:224/266 of query aligns to 5:229/280 of 5x40A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 82% coverage: 6:222/266 of query aligns to 21:235/378 of P69874
Sites not aligning to the query:
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/238 of 6s8gA
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/233 of 6b8bA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/235 of 6mhzA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 2:233/234 of 4p31A
6mbnA Lptb e163q in complex with atp (see paper)
32% identity, 87% coverage: 2:232/266 of query aligns to 3:234/241 of 6mbnA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
33% identity, 82% coverage: 18:236/266 of query aligns to 23:244/280 of 5d3mA
Sites not aligning to the query:
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
33% identity, 82% coverage: 18:236/266 of query aligns to 20:241/278 of 8bmpA
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 80% coverage: 13:224/266 of query aligns to 13:225/241 of 4u00A
Sites not aligning to the query:
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
31% identity, 88% coverage: 3:236/266 of query aligns to 5:241/278 of 8bmsA
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 10:222/266 of query aligns to 13:228/353 of 1oxvD
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 10:222/266 of query aligns to 13:228/353 of 1oxvA
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
30% identity, 80% coverage: 10:222/266 of query aligns to 13:228/353 of 1oxuA
Q97UY8 Glucose import ATP-binding protein GlcV; EC 7.5.2.- from Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) (Sulfolobus solfataricus) (see paper)
30% identity, 80% coverage: 10:222/266 of query aligns to 13:228/353 of Q97UY8
>SM_b20058 FitnessBrowser__Smeli:SM_b20058
MTLSASGVSWSAGGVEILKDVSLTVETGEFLGIIGPNGSGKTSLMSLISGIRKPKRGEVL
LDGCPIGTLGRRTVAQRLALVEQQAETGERITARQAVELGRTPYLGPLSPWSPEDDAIVG
AALANVDMAHLADRLWHTLSGGERQRLHIARALAQQSKILLLDEPTNHLDIGHQISLLDL
VRRQDLTVVAALHDLNHAAMFCDRIAVMQAGRLVALGRPREVLTVERIRAVFGIEVEVEH
EFDGSCSIRYRARRPRPLAAIAAVGA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory