Comparing SM_b20124 FitnessBrowser__Smeli:SM_b20124 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
36% identity, 98% coverage: 6:502/508 of query aligns to 4:494/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 43% coverage: 6:221/508 of query aligns to 1:215/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
32% identity, 44% coverage: 12:232/508 of query aligns to 8:226/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
30% identity, 45% coverage: 5:232/508 of query aligns to 2:228/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
30% identity, 45% coverage: 5:232/508 of query aligns to 2:228/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
30% identity, 45% coverage: 5:232/508 of query aligns to 2:228/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
30% identity, 45% coverage: 5:232/508 of query aligns to 2:228/242 of 2oljA
4yerA Crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution
30% identity, 56% coverage: 4:287/508 of query aligns to 2:278/285 of 4yerA
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 43% coverage: 4:221/508 of query aligns to 3:224/233 of P75957
7mdyC Lolcde nucleotide-bound
31% identity, 43% coverage: 6:221/508 of query aligns to 2:221/226 of 7mdyC
7arlD Lolcde in complex with lipoprotein and adp (see paper)
31% identity, 43% coverage: 6:221/508 of query aligns to 2:221/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 43% coverage: 4:221/508 of query aligns to 2:223/229 of 7v8iD
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
33% identity, 40% coverage: 24:228/508 of query aligns to 23:227/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
33% identity, 40% coverage: 24:228/508 of query aligns to 24:228/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
33% identity, 40% coverage: 24:228/508 of query aligns to 24:228/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
33% identity, 40% coverage: 24:228/508 of query aligns to 24:228/344 of 6cvlD
Sites not aligning to the query:
3d31A Modbc from methanosarcina acetivorans (see paper)
32% identity, 40% coverage: 24:228/508 of query aligns to 18:214/348 of 3d31A
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
29% identity, 42% coverage: 12:222/508 of query aligns to 32:243/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
29% identity, 42% coverage: 12:222/508 of query aligns to 32:243/382 of 7aheC
Sites not aligning to the query:
7ahdC Opua (e190q) occluded (see paper)
29% identity, 42% coverage: 12:222/508 of query aligns to 32:243/260 of 7ahdC
Sites not aligning to the query:
>SM_b20124 FitnessBrowser__Smeli:SM_b20124
MAGKQLLLMDGIHKRFGPLIVSAGVTLDVEENEIHALLGENGAGKTVLMSILCGVLSPNE
GQIVFKGRPLKLGSPREAIKHRIGMVHQHFMLVPNLTVAENYVLGQGSPFSMIRDMRAVH
ARILELSDRYGLDVAPDALVSSLSVGERQRVEILKVLYHGIELLILDEPTAVLTPQETDR
LLHLLRQLVADGKTVIFISHKLDEVMRVSDRVSVMRDAKVVRTVKTSETTARELARMMVG
RDVLMYLPRAPLEPGRVVLSVEHLSCDGEAGLPALRDVSFEVRANEIVGIAGVSGNGQSE
LALALTGLLPVASGSVTLDGTQLAGLSSYEINQLPMAHIPEDRHRMGIVLPLPLTENVIL
QRFDKPPFSSRGLLDLNEITRQTRDLMRRFKVKASGPGDRIRNLSGGNQQKLVVGRELDR
RFDFLLINQLTRGIDIGATELVMHKILEQRSAGKAILLISTELEELFTLSDRILVMYEGR
LVGEIPPDRSRLEEIGLLMAGKSPLSAA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory