SitesBLAST
Comparing SM_b20130 SM_b20130 dehydrogenase to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1ffuC Carbon monoxide dehydrogenase from hydrogenophaga pseudoflava which lacks the mo-pyranopterin moiety of the molybdenum cofactor (see paper)
35% identity, 98% coverage: 4:283/287 of query aligns to 6:283/287 of 1ffuC
- binding flavin-adenine dinucleotide: K29 (≠ S27), L30 (≠ I28), A32 (= A30), G33 (= G31), G34 (= G32), H35 (≠ T33), S36 (≠ D34), L37 (= L35), I54 (= I52), I101 (≠ L100), A102 (≠ G101), G110 (≠ A109), T111 (= T110), G114 (= G113), D115 (≠ N114), A117 (≠ C116), N123 (≠ A122), D124 (= D123), L161 (= L160), V166 (≠ I165), M167 (≠ V166), W193 (≠ L193)
4zohB Crystal structure of glyceraldehyde oxidoreductase (see paper)
33% identity, 96% coverage: 4:279/287 of query aligns to 6:269/274 of 4zohB
- active site: Y256 (= Y266)
- binding flavin-adenine dinucleotide: R28 (≠ S27), P29 (≠ I28), A31 (= A30), G32 (= G31), G33 (= G32), H34 (≠ T33), S35 (≠ D34), L36 (= L35), H77 (≠ V77), I95 (≠ L100), G96 (= G101), V100 (= V105), T105 (= T110), G108 (= G113), S109 (≠ N114), S111 (≠ C116), A117 (= A122), D118 (= D123), L160 (≠ I165), V161 (= V166), D185 (≠ E192), F186 (≠ L193)
1n5wC Crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form (see paper)
30% identity, 96% coverage: 4:279/287 of query aligns to 6:279/287 of 1n5wC
P19920 Carbon monoxide dehydrogenase medium chain; CO dehydrogenase subunit M; CO-DH M; EC 1.2.5.3 from Afipia carboxidovorans (strain ATCC 49405 / DSM 1227 / KCTC 32145 / OM5) (Oligotropha carboxidovorans) (see 2 papers)
30% identity, 96% coverage: 4:279/287 of query aligns to 6:279/288 of P19920
3hrdG Crystal structure of nicotinate dehydrogenase (see paper)
29% identity, 96% coverage: 1:276/287 of query aligns to 1:281/292 of 3hrdG
- binding flavin-adenine dinucleotide: I29 (= I28), A31 (= A30), G32 (= G31), G33 (= G32), T34 (= T33), D35 (= D34), F77 (≠ V77), V100 (≠ L100), G101 (= G101), I105 (≠ V105), T110 (= T110), G113 (= G113), N114 (= N114), S116 (≠ C116), T117 (≠ R117), G122 (≠ A122), D123 (= D123), I168 (= I165), M169 (≠ V166)
Q0QLF4 Nicotinate dehydrogenase FAD-subunit; NDH; Nicotinic acid hydroxylase FAD-subunit; NAH; EC 1.17.1.5 from Eubacterium barkeri (Clostridium barkeri) (see paper)
29% identity, 96% coverage: 1:276/287 of query aligns to 1:281/296 of Q0QLF4
- 29:36 (vs. 28:35, 100% identical) binding
- G101 (= G101) binding
- TIGGN 110:114 (≠ TIVGN 110:114) binding
- D123 (= D123) binding
- R160 (= R157) binding
- M169 (≠ V166) binding
- K187 (= K184) binding
2w54A Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus in complex with bound inhibitor pterin-6-aldehyde (see paper)
32% identity, 94% coverage: 9:279/287 of query aligns to 167:435/450 of 2w54A
- binding flavin-adenine dinucleotide: L189 (≠ I28), A191 (= A30), G192 (= G31), G193 (= G32), T194 (= T33), D195 (= D34), V196 (≠ L35), W199 (≠ E38), L213 (≠ I52), F258 (≠ L100), A259 (≠ G101), A267 (= A109), T268 (= T110), G271 (= G113), N272 (= N114), A274 (≠ C116), N275 (≠ R117), G280 (≠ A122), D281 (= D123), R318 (≠ L160), V324 (= V166), Q347 (≠ M191)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42
- binding fe2/s2 (inorganic) cluster: 38, 39, 40, 42, 44, 45, 47, 63, 103, 104, 106, 134, 135, 136
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 102, 136
1jroA Crystal structure of xanthine dehydrogenase from rhodobacter capsulatus (see paper)
32% identity, 94% coverage: 9:279/287 of query aligns to 167:435/450 of 1jroA
- binding flavin-adenine dinucleotide: L189 (≠ I28), A191 (= A30), G192 (= G31), G193 (= G32), T194 (= T33), D195 (= D34), V196 (≠ L35), F258 (≠ L100), A259 (≠ G101), T268 (= T110), G271 (= G113), N272 (= N114), A274 (≠ C116), G280 (≠ A122), D281 (= D123), R318 (≠ L160), V324 (= V166)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 42, 43
- binding fe2/s2 (inorganic) cluster: 37, 38, 39, 40, 42, 44, 45, 47, 63, 103, 106, 134, 136
1t3qC Crystal structure of quinoline 2-oxidoreductase from pseudomonas putida 86 (see paper)
32% identity, 99% coverage: 4:286/287 of query aligns to 6:283/285 of 1t3qC
- binding flavin-adenine dinucleotide: I29 (= I28), A31 (= A30), G32 (= G31), G33 (= G32), Q34 (≠ T33), S35 (≠ D34), L36 (= L35), V100 (≠ L100), A101 (≠ G101), V105 (= V105), T110 (= T110), G113 (= G113), S114 (≠ N114), A116 (≠ C116), A122 (= A122), E123 (≠ D123), L166 (≠ V166), Y190 (≠ L193)
Q8GUQ8 Xanthine dehydrogenase 1; AtXDH1; EC 1.17.1.4 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 89% coverage: 6:260/287 of query aligns to 264:535/1361 of Q8GUQ8
- W364 (≠ L99) mutation to A: Decreases activity 8-fold.
- Y421 (≠ P155) mutation to A: Decreases activity 4-fold.
Sites not aligning to the query:
- 831 E→A: Loss of activity.
- 909 R→A: Decreases activity 12-fold.
- 1297 E→A: Decreases activity 40-fold.
7dqxE Crystal structure of xanthine dehydrogenase family protein
29% identity, 99% coverage: 1:283/287 of query aligns to 1:284/293 of 7dqxE
- binding flavin-adenine dinucleotide: K29 (≠ S27), I30 (= I28), I31 (= I29), G33 (= G31), G34 (= G32), Q35 (≠ T33), S36 (≠ D34), L37 (= L35), H78 (≠ V77), I101 (≠ L100), A102 (≠ G101), I106 (≠ V105), G110 (≠ A109), T111 (= T110), G113 (≠ V112), G114 (= G113), S115 (≠ N114), A117 (≠ C116), A123 (= A122), E124 (≠ D123), I167 (≠ V166), Y193 (≠ L193)
P47989 Xanthine dehydrogenase/oxidase; EC 1.17.1.4; EC 1.17.3.2 from Homo sapiens (Human) (see 4 papers)
27% identity, 78% coverage: 6:229/287 of query aligns to 236:469/1333 of P47989
- 257:264 (vs. 28:35, 25% identical) binding
- F337 (≠ L100) binding
- SVGGN 347:351 (≠ TIVGN 110:114) binding
- D360 (= D123) binding
- K395 (≠ R157) to M: in dbSNP:rs34929837
- K422 (= K184) binding
Sites not aligning to the query:
- 133 E → K: in dbSNP:rs45447191
- 172 G → R: in dbSNP:rs45523133
- 235 T → M: in dbSNP:rs45469499
- 509 modified: Disulfide link with 1318, In oxidase form
- 536 modified: Disulfide link with 993, In oxidase form
- 555 P → S: in dbSNP:rs45577338
- 584 D → A: in dbSNP:rs45491693
- 607 R → Q: in dbSNP:rs45442092
- 617 K → N: in dbSNP:rs45442398
- 623 T → I: in dbSNP:rs45448694
- 646 I → V: in dbSNP:rs17323225
- 703 I → V: in dbSNP:rs17011368
- 763 L → F: in a breast cancer sample; somatic mutation
- 791 R → G: in a breast cancer sample; somatic mutation; dbSNP:rs775646772
- 910 T → M: in dbSNP:rs669884
- 993 modified: Disulfide link with 536, In oxidase form
- 1091 V → L: in dbSNP:rs45619033
- 1109 N → T: in dbSNP:rs45547640
- 1150 P → R: in dbSNP:rs1042036
- 1176 R → C: in dbSNP:rs45624433
- 1296 R → W: in dbSNP:rs45564939
- 1318 modified: Disulfide link with 509, In oxidase form
2e1qA Crystal structure of human xanthine oxidoreductase mutant, glu803val (see paper)
27% identity, 78% coverage: 6:229/287 of query aligns to 210:443/1307 of 2e1qA
- binding flavin-adenine dinucleotide: K230 (≠ S27), L231 (≠ I28), V232 (≠ I29), V233 (≠ A30), G234 (= G31), N235 (≠ G32), T236 (= T33), E237 (≠ D34), I238 (≠ L35), F311 (≠ L100), A312 (≠ G101), V316 (= V105), A320 (= A109), S321 (≠ T110), G324 (= G113), N325 (= N114), I327 (≠ C116), T328 (≠ R117), S333 (≠ A122), D334 (= D123), I377 (= I165), L378 (≠ V166)
Sites not aligning to the query:
- active site: 742, 777, 855, 859, 887, 1235, 1236
- binding bicarbonate ion: 814, 815, 852, 886, 889, 890, 893
- binding calcium ion: 715, 716, 718, 741, 747, 780, 781, 784, 811, 812
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 719
- binding hydroxy(dioxo)molybdenum: 773, 774, 887, 1053, 1054, 1236
3unaA Crystal structure of bovine milk xanthine dehydrogenase with NAD bound (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 206:439/1286 of 3unaA
- binding flavin-adenine dinucleotide: L227 (≠ I28), V228 (≠ I29), V229 (≠ A30), G230 (= G31), N231 (≠ G32), T232 (= T33), E233 (≠ D34), I234 (≠ L35), F307 (≠ L100), A308 (≠ G101), A316 (= A109), S317 (≠ T110), G320 (= G113), N321 (= N114), I323 (≠ C116), T324 (≠ R117), S329 (≠ A122), D330 (= D123), I373 (= I165), L374 (≠ V166)
- binding nicotinamide-adenine-dinucleotide: P327 (= P120), Y363 (≠ P155), R364 (≠ G156), A430 (= A220), D431 (≠ P221)
Sites not aligning to the query:
- active site: 729, 764, 842, 846, 874, 1222, 1223
- binding calcium ion: 829, 832, 833, 836, 869, 870
- binding carbonate ion: 801, 802, 871, 872, 876, 877, 880
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 69, 71, 110, 111, 112, 114, 146, 148, 706
- binding nicotinamide-adenine-dinucleotide: 471, 478
3ax7A Bovine xanthine oxidase, protease cleaved form (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 177:410/1225 of 3ax7A
- binding flavin-adenine dinucleotide: K197 (≠ S27), L198 (≠ I28), V199 (≠ I29), V200 (≠ A30), G201 (= G31), N202 (≠ G32), T203 (= T33), E204 (≠ D34), I205 (≠ L35), F278 (≠ L100), A279 (≠ G101), V283 (= V105), A287 (= A109), S288 (≠ T110), G291 (= G113), N292 (= N114), I294 (≠ C116), T295 (≠ R117), S300 (≠ A122), D301 (= D123), L345 (≠ V166)
Sites not aligning to the query:
- active site: 666, 701, 779, 783, 811, 1159, 1160
- binding bicarbonate ion: 738, 739, 776, 808, 809, 814, 817
- binding calcium ion: 766, 769, 770, 773, 806, 807
- binding flavin-adenine dinucleotide: 45
- binding fe2/s2 (inorganic) cluster: 41, 42, 43, 45, 47, 48, 50, 70, 72, 112, 113, 115, 147, 149, 643
- binding {[(5aR,8R,9aR)-2-amino-4-oxo-6,7-di(sulfanyl-kappaS)-3,5,5a,8,9a,10-hexahydro-4H-pyrano[3,2-g]pteridin-8-yl]methyl dihydrogenato(2-) phosphate}(hydroxy)oxo(thioxo)molybdenum: 111, 149, 695, 696, 697, 698, 810, 811, 937, 938, 939, 977, 978, 979, 981, 1093, 1160
3amzA Bovine xanthine oxidoreductase urate bound form (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 208:441/1291 of 3amzA
- binding flavin-adenine dinucleotide: L229 (≠ I28), V230 (≠ I29), V231 (≠ A30), G232 (= G31), N233 (≠ G32), T234 (= T33), E235 (≠ D34), I236 (≠ L35), F309 (≠ L100), A318 (= A109), S319 (≠ T110), G322 (= G113), N323 (= N114), I325 (≠ C116), T326 (≠ R117), S331 (≠ A122), D332 (= D123), I375 (= I165), L376 (≠ V166)
- binding 1,4-dihydronicotinamide adenine dinucleotide: S328 (= S119), P329 (= P120), I330 (≠ S121), Y365 (≠ P155), R366 (≠ G156), D402 (≠ E192), I403 (≠ L193), G430 (≠ A218), A432 (= A220), D433 (≠ P221)
Sites not aligning to the query:
- active site: 731, 766, 844, 848, 876, 1224, 1225
- binding bicarbonate ion: 803, 804, 873, 874, 878, 879, 882
- binding calcium ion: 831, 834, 835, 838, 871, 872
- binding flavin-adenine dinucleotide: 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 708
- binding 1,4-dihydronicotinamide adenine dinucleotide: 473, 480, 1189
- binding uric acid: 766, 844, 878, 973, 974, 1043, 1225
3am9A Complex of bovine xanthine dehydrogenase and trihydroxy fyx-051 (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 208:441/1293 of 3am9A
- binding flavin-adenine dinucleotide: K228 (≠ S27), L229 (≠ I28), V231 (≠ A30), G232 (= G31), N233 (≠ G32), T234 (= T33), E235 (≠ D34), I236 (≠ L35), F309 (≠ L100), A310 (≠ G101), V314 (= V105), A318 (= A109), S319 (≠ T110), G322 (= G113), N323 (= N114), I325 (≠ C116), T326 (≠ R117), D332 (= D123), L376 (≠ V166), K394 (= K184)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding bicarbonate ion: 805, 806, 875, 876, 877, 884
- binding calcium ion: 707, 709, 802, 803, 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 111, 112, 114, 146, 148, 710
- binding 4-[5-(2,6-dioxo-1,2,3,6-tetrahydropyridin-4-yl)-1H-1,2,4-triazol-3-yl]-6-oxo-1,6-dihydropyridine-2-carbonitrile: 614, 768, 839, 842, 846, 880, 975, 980, 1045, 1227
1vdvA Bovine milk xanthine dehydrogenase y-700 bound form (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 208:441/1299 of 1vdvA
- binding flavin-adenine dinucleotide: L229 (≠ I28), V230 (≠ I29), V231 (≠ A30), G232 (= G31), N233 (≠ G32), T234 (= T33), E235 (≠ D34), I236 (≠ L35), F309 (≠ L100), A310 (≠ G101), A318 (= A109), S319 (≠ T110), G322 (= G113), N323 (= N114), I325 (≠ C116), T326 (≠ R117), S331 (≠ A122), D332 (= D123), I375 (= I165), L376 (≠ V166)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding calcium ion: 708, 710, 803, 804, 834, 837, 838, 841, 874, 875
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 711
- binding 1-[3-cyano-4-(neopentyloxy)phenyl]-1h-pyrazole-4-carboxylic acid: 769, 840, 843, 847, 881, 976, 977, 978, 981, 1043, 1046
1v97A Crystal structure of bovine milk xanthine dehydrogenase fyx-051 bound form (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 208:441/1298 of 1v97A
- binding flavin-adenine dinucleotide: K228 (≠ S27), L229 (≠ I28), V230 (≠ I29), V231 (≠ A30), G232 (= G31), N233 (≠ G32), T234 (= T33), E235 (≠ D34), I236 (≠ L35), F309 (≠ L100), A310 (≠ G101), A318 (= A109), S319 (≠ T110), G322 (= G113), N323 (= N114), I325 (≠ C116), T326 (≠ R117), S331 (≠ A122), D332 (= D123), I375 (= I165), L376 (≠ V166)
Sites not aligning to the query:
- active site: 733, 768, 846, 850, 878, 1226, 1227
- binding calcium ion: 833, 836, 837, 840, 873, 874
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 710
- binding 4-(5-pyridin-4-yl-1h-1,2,4-triazol-3-yl)pyridine-2-carbonitrile: 768, 839, 846, 880, 975, 980, 1042, 1044, 1045, 1227
1n5xA Xanthine dehydrogenase from bovine milk with inhibitor tei-6720 bound (see paper)
25% identity, 78% coverage: 6:229/287 of query aligns to 208:441/1290 of 1n5xA
- binding flavin-adenine dinucleotide: L229 (≠ I28), V231 (≠ A30), G232 (= G31), N233 (≠ G32), T234 (= T33), E235 (≠ D34), I236 (≠ L35), F309 (≠ L100), A310 (≠ G101), A318 (= A109), S319 (≠ T110), G322 (= G113), N323 (= N114), I325 (≠ C116), T326 (≠ R117), D332 (= D123), L376 (≠ V166)
Sites not aligning to the query:
- active site: 734, 769, 847, 851, 879, 1227, 1228
- binding flavin-adenine dinucleotide: 43, 44
- binding fe2/s2 (inorganic) cluster: 40, 41, 42, 44, 46, 47, 49, 71, 110, 111, 112, 114, 146, 148, 711
- binding 2-(3-cyano-4-isobutoxy-phenyl)-4-methyl-5-thiazole-carboxylic acid: 615, 738, 769, 840, 847, 881, 976, 977, 978, 981
Query Sequence
>SM_b20130 SM_b20130 dehydrogenase
MKPFEYYEPASLAEASDLLRRLGKDASIIAGGTDLLVEMKEELRSVLHLVNIKKIPNLRD
FTYDPAAGLRFGALVTVREIETSPHVIGNYPNLAKAVSLLGSVQVRNRATIVGNICRASP
SADTIPPLIADGASLSVYNGGTERTILLEDFFTGPGRTVLSPGDIVTGISLPAPRPTSGR
AYIKHGRRKAMELATVGVAVSIEHVAGQCSDIRIALGAVAPTVIRARRTEDLIRGRRIDA
ALLAEAAESAMQEATPIGNVRASAAYRRDMVGVLTRRAIGYAMGGAQ
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory