Comparing SM_b20140 FitnessBrowser__Smeli:SM_b20140 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3l21B The crystal structure of a dimeric mutant of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis - dhdps- a204r
37% identity, 94% coverage: 6:279/293 of query aligns to 11:280/295 of 3l21B
1xxxA Crystal structure of dihydrodipicolinate synthase (dapa, rv2753c) from mycobacterium tuberculosis (see paper)
37% identity, 94% coverage: 6:279/293 of query aligns to 12:281/296 of 1xxxA
5j5dA Crystal structure of dihydrodipicolinate synthase from mycobacterium tuberculosis in complex with alpha-ketopimelic acid (see paper)
37% identity, 94% coverage: 6:279/293 of query aligns to 13:282/297 of 5j5dA
P9WP25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
37% identity, 94% coverage: 6:279/293 of query aligns to 16:285/300 of P9WP25
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
34% identity, 87% coverage: 1:255/293 of query aligns to 1:259/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
34% identity, 87% coverage: 1:255/293 of query aligns to 1:259/294 of 4i7wA
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
36% identity, 75% coverage: 7:225/293 of query aligns to 10:227/291 of 3di1B
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
36% identity, 75% coverage: 7:225/293 of query aligns to 10:227/295 of Q5HG25
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
31% identity, 95% coverage: 4:282/293 of query aligns to 9:284/307 of 4fhaA
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 97% coverage: 6:290/293 of query aligns to 9:291/295 of 5ktlA
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 100% coverage: 1:293/293 of query aligns to 2:295/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 100% coverage: 1:293/293 of query aligns to 1:294/294 of Q9X1K9
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
31% identity, 84% coverage: 1:247/293 of query aligns to 1:240/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
31% identity, 84% coverage: 1:247/293 of query aligns to 1:240/296 of 7lvlA
7kg2A Dihydrodipicolinate synthase (dhdps) from c.Jejuni, h59k mutant with pyruvate bound in the active site and l-histidine bound at the allosteric site
30% identity, 98% coverage: 5:292/293 of query aligns to 7:293/296 of 7kg2A
7kkdB Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84a mutant with pyruvate bound in the active site and r,r-bislysine bound at the allosteric site
30% identity, 98% coverage: 5:292/293 of query aligns to 17:303/306 of 7kkdB
6u01B Dihydrodipicolinate synthase (dhdps) from c.Jejuni, n84d mutant with pyruvate bound in the active site (see paper)
30% identity, 98% coverage: 5:292/293 of query aligns to 7:293/296 of 6u01B
4m19A Dihydrodipicolinate synthase from c. Jejuni with pyruvate bound to the active site and lysine bound to allosteric site (see paper)
30% identity, 98% coverage: 5:292/293 of query aligns to 7:293/296 of 4m19A
4ptnA Crystal structure of yage, a kdg aldolase protein in complex with magnesium cation coordinated l-glyceraldehyde (see paper)
31% identity, 75% coverage: 11:230/293 of query aligns to 12:234/298 of 4ptnA
Sites not aligning to the query:
4onvA Crystal structure of yage, a kdg aldolase protein in complex with 2- keto-3-deoxy gluconate
31% identity, 75% coverage: 11:230/293 of query aligns to 12:234/298 of 4onvA
Sites not aligning to the query:
>SM_b20140 FitnessBrowser__Smeli:SM_b20140
MSKKAFVALVTCFNEDETINYDATRAQVRRQVAAGNNIMCAGTNGDFTALTHEEKIRLTE
EVVDEVGGRVDVIVNAGMPATFETLQLARAFDRIGVSGIAVITPFFIACTQDGLIRHFST
VADAVETPVYLYDIPSRTQNHIEPETALKLSAHGNIAGIKDSGGAQDTLEAYLQVARDVP
GFEVYSGPDHLVLWSLQNGAAGCISGLGNAMPEVLAGILSAFNSGNIAEAERRQAIYTAF
RTELYALGFPPALVKRSLYLQDPSVGASRQPALLPSEEQDAKIREILVRHRLL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory