Comparing SM_b20141 FitnessBrowser__Smeli:SM_b20141 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0AAH4 Putrescine export system ATP-binding protein SapD from Escherichia coli (strain K12) (see paper)
41% identity, 47% coverage: 5:264/548 of query aligns to 3:267/330 of P0AAH4
P30750 Methionine import ATP-binding protein MetN; EC 7.4.2.11 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 43% coverage: 287:523/548 of query aligns to 17:248/343 of P30750
Sites not aligning to the query:
3tuzC Inward facing conformations of the metni methionine abc transporter: cy5 semet soak crystal form (see paper)
39% identity, 43% coverage: 287:523/548 of query aligns to 18:249/344 of 3tuzC
Sites not aligning to the query:
3tuiC Inward facing conformations of the metni methionine abc transporter: cy5 native crystal form (see paper)
39% identity, 43% coverage: 287:523/548 of query aligns to 18:249/344 of 3tuiC
Sites not aligning to the query:
6cvlD Crystal structure of the escherichia coli atpgs-bound metni methionine abc transporter in complex with its metq binding protein (see paper)
39% identity, 43% coverage: 287:523/548 of query aligns to 18:249/344 of 6cvlD
Sites not aligning to the query:
Q8RDH4 Dipeptide transport ATP-binding protein DppD; EC 7.4.2.9 from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) (Thermoanaerobacter tengcongensis) (see paper)
39% identity, 46% coverage: 5:258/548 of query aligns to 4:257/326 of Q8RDH4
Sites not aligning to the query:
4fwiB Crystal structure of the nucleotide-binding domain of a dipeptide abc transporter (see paper)
39% identity, 46% coverage: 5:258/548 of query aligns to 3:256/310 of 4fwiB
Sites not aligning to the query:
7z15I E. Coli c-p lyase bound to a phnk/phnl dual abc dimer and adp + pi (see paper)
37% identity, 45% coverage: 273:520/548 of query aligns to 1:248/253 of 7z15I
7z18I E. Coli c-p lyase bound to a phnk abc dimer and atp (see paper)
37% identity, 45% coverage: 273:520/548 of query aligns to 1:248/250 of 7z18I
7z16I E. Coli c-p lyase bound to phnk/phnl dual abc dimer with amppnp and phnk e171q mutation (see paper)
37% identity, 45% coverage: 273:520/548 of query aligns to 1:248/250 of 7z16I
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
36% identity, 45% coverage: 274:520/548 of query aligns to 1:240/241 of 4u00A
3c4jA Abc protein artp in complex with atp-gamma-s
37% identity, 44% coverage: 275:517/548 of query aligns to 3:239/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
37% identity, 44% coverage: 275:517/548 of query aligns to 3:239/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
37% identity, 44% coverage: 275:517/548 of query aligns to 3:239/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
37% identity, 44% coverage: 275:517/548 of query aligns to 3:239/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
36% identity, 45% coverage: 275:520/548 of query aligns to 1:240/240 of 4ymuJ
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
34% identity, 45% coverage: 274:517/548 of query aligns to 16:249/378 of P69874
Sites not aligning to the query:
7ahhC Opua inhibited inward-facing, sbd docked (see paper)
32% identity, 43% coverage: 279:516/548 of query aligns to 30:263/382 of 7ahhC
Sites not aligning to the query:
7aheC Opua inhibited inward facing (see paper)
32% identity, 43% coverage: 279:516/548 of query aligns to 30:263/382 of 7aheC
Sites not aligning to the query:
1g291 Malk (see paper)
33% identity, 44% coverage: 280:518/548 of query aligns to 8:242/372 of 1g291
Sites not aligning to the query:
>SM_b20141 FitnessBrowser__Smeli:SM_b20141
MAEHLLEVRNLSVEFHTAAGVVHAVKSISYHLDKGETLAILGESGSGKSVSSSAIMNLID
MPPGRISSGEILLDGRDLLTMPAEERREVNGRRVAMIFQDPLSHLNPVYSVGWQISEAMT
THGLAGSKAREEALRLLRRVGIPEPERAMRKYPHEFSGGQRQRVMIAMALALRPDLLIAD
EPTTALDVTVQAEVLKLLKELQRETGMAVLIITHDLGVVSEIADRVVVMEKGAIVEAGTV
REIYKNPQHPYTQKLIAAAPGKGAMHEPGARAEPLLSVRDVRKTYGSFEALKGISFDLMP
GETMAVVGESGSGKSTLARALLRLDEPDSGTALWKGRDLFALSPAELYKLRRDLQMVFQD
PTQSLNPRMTVYQLISEAWVIHPDILPKAKWRERVAELLVQVGLSAEHMSRYPHQFSGGQ
RQRIAIARALALEPQLIICDEAVSALDVSVQAQVIELLDRLRREMGIAFIFIAHDLPVVR
DFADYVMVMQQGEVVELGTVREVFDTPRQAYTRALLAASLSPDPDAKAGHLASVPAEAAD
ILIPKRSH
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory