Comparing SM_b20232 SM_b20232 sugar ABC transporter permease to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94529 Arabinooligosaccharides transport system permease protein AraP from Bacillus subtilis (strain 168) (see paper)
29% identity, 89% coverage: 8:287/314 of query aligns to 14:288/313 of P94529
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
31% identity, 75% coverage: 64:298/314 of query aligns to 239:490/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
31% identity, 75% coverage: 64:298/314 of query aligns to 254:505/514 of P02916
7cagA Mycobacterium smegmatis lpqy-sugabc complex in the catalytic intermediate state (see paper)
26% identity, 76% coverage: 66:304/314 of query aligns to 49:278/285 of 7cagA
>SM_b20232 SM_b20232 sugar ABC transporter permease
MTTIAQSAARRRHAGRTRLSAKHREWIAGYLFVLPDALGLFIFLGVPMALSLVLSVFEVN
GFGGYSFVGARNYLRMWNDPLFWKGARVTALYAAMLVPLLYVCGLGLALLVQRTDRFNAI
MRSMFFAPHMVSLVVVALVWQFMVVDKIGVVSRLTAALDIGGISLLGDPNFALITIVLVS
VWFLMGFYMLIFLGGLQDIPRQYYEAAMIDGAGAIARFWFITLPLLKPTSFFVIMVSMVA
AVAGAQAFDIIYVMTKGGPANATSVLIVYIYQQAFGFGAFGYAAAMASILVVALMIVTAV
FFALTRGGRFHHEQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory