SitesBLAST
Comparing SM_b20262 FitnessBrowser__Smeli:SM_b20262 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1eyyA Crystal structure of the NADP+ dependent aldehyde dehydrogenase from vibrio harveyi. (see paper)
48% identity, 93% coverage: 34:503/505 of query aligns to 20:487/504 of 1eyyA
3ty7B Crystal structure of aldehyde dehydrogenase family protein from staphylococcus aureus
26% identity, 87% coverage: 8:448/505 of query aligns to 7:435/454 of 3ty7B
3jz4A Crystal structure of e. Coli NADP dependent enzyme (see paper)
28% identity, 85% coverage: 10:439/505 of query aligns to 13:433/481 of 3jz4A
- active site: N156 (= N157), K179 (= K182), E254 (= E263), C288 (= C300), E385 (= E389)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: P154 (≠ A155), W155 (≠ S156), K179 (= K182), A181 (≠ H184), S182 (= S185), A212 (≠ S219), G216 (= G223), G232 (= G239), S233 (= S240), I236 (≠ G243), C288 (= C300), K338 (≠ D344), E385 (= E389), F387 (= F391)
Sites not aligning to the query:
P25526 Succinate-semialdehyde dehydrogenase [NADP(+)] GabD; SSDH; Glutarate-semialdehyde dehydrogenase; EC 1.2.1.79; EC 1.2.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 85% coverage: 10:439/505 of query aligns to 14:434/482 of P25526
P28037 Cytosolic 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH; FDH; Aldehyde dehydrogenase family 1 member L1; FBP-CI; EC 1.5.1.6 from Rattus norvegicus (Rat) (see 5 papers)
26% identity, 77% coverage: 10:399/505 of query aligns to 425:814/902 of P28037
- IPW 571:573 (≠ GAS 154:156) binding
- KPAQ 597:600 (≠ KGHS 182:185) binding
- GSLVGQ 630:635 (≠ SRDVGH 219:224) binding
- GS 650:651 (= GS 239:240) binding
- E673 (= E263) mutation to A: Loss of aldehyde dehydrogenase activity.
- EL 673:674 (= EL 263:264) binding
- C707 (= C300) mutation to A: Loss of formyltetrahydrofolate dehydrogenase activity. No effect on formyltetrahydrofolate hydrolase activity. No effect on NADP binding. No effect on homotetramerization.
- K757 (≠ N353) binding
- ESF 804:806 (≠ EVF 389:391) binding
Sites not aligning to the query:
- 142 Essential for catalytic activity; D→A: Loss of formyltetrahydrofolate dehydrogenase activity. Loss of formyltetrahydrofolate hydrolase activity. No effect on aldehyde dehydrogenase activity.
- 354 modified: O-(pantetheine 4'-phosphoryl)serine; S→A: Loss of phosphopantetheinylation. Loss of formyltetrahydrofolate dehydrogenase activity. No effect on hydrolase and aldehyde dehydrogenase activities in vitro.
4go2A Crystal structure of thE C-terminal domain of 10'formyltetrahydrofolate dehydrogenase in complex with thio-NADP (see paper)
26% identity, 77% coverage: 10:399/505 of query aligns to 21:410/498 of 4go2A
- active site: N170 (= N157), K193 (= K182), E269 (= E263), C303 (= C300), E400 (= E389)
- binding 7-thionicotinamide-adenine-dinucleotide phosphate: V166 (≠ F153), I167 (≠ G154), P168 (≠ A155), W169 (≠ S156), K193 (= K182), A195 (≠ H184), Q196 (≠ S185), S225 (≠ G218), G226 (≠ S219), G230 (= G223), Q231 (≠ H224), F244 (= F237), G246 (= G239), S247 (= S240), V250 (≠ G243), I254 (≠ L247), E269 (= E263), G271 (= G265), C303 (= C300), E400 (= E389), F402 (= F391)
Sites not aligning to the query:
2o2rA Crystal structure of thE C-terminal domain of rat 10'formyltetrahydrofolate dehydrogenase in complex with NADPH (see paper)
26% identity, 77% coverage: 10:399/505 of query aligns to 21:410/498 of 2o2rA
- active site: N170 (= N157), K193 (= K182), E269 (= E263), C303 (= C300), E400 (= E389)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: V166 (≠ F153), I167 (≠ G154), W169 (≠ S156), K193 (= K182), A195 (≠ H184), Q196 (≠ S185), S225 (≠ G218), G226 (≠ S219), G230 (= G223), Q231 (≠ H224), F244 (= F237), S247 (= S240), V250 (≠ G243), I254 (≠ L247)
Sites not aligning to the query:
7rluA Structure of aldh1l1 (10-formyltetrahydrofolate dehydrogenase) in complex with NADP (see paper)
26% identity, 77% coverage: 10:399/505 of query aligns to 106:495/583 of 7rluA
Sites not aligning to the query:
5x5uA Crystal structure of alpha-ketoglutarate-semialdehyde dehydrogenase (kgsadh) complexed with NAD (see paper)
31% identity, 62% coverage: 10:323/505 of query aligns to 8:305/476 of 5x5uA
- active site: N151 (= N157), K174 (= K182), E249 (= E263), C283 (= C300)
- binding glycerol: D15 (= D17), A16 (≠ G18), A17 (= A19), G19 (vs. gap)
- binding nicotinamide-adenine-dinucleotide: P149 (≠ A155), P207 (≠ S219), A208 (≠ R220), S211 (≠ G223), G227 (= G239), S228 (= S240), V231 (≠ G243)
Sites not aligning to the query:
5x5tA Crystal structure of alpha-ketoglutarate semialdehyde dehydrogenase (kgsadh) from azospirillum brasilense (see paper)
31% identity, 62% coverage: 10:323/505 of query aligns to 8:305/476 of 5x5tA
Sites not aligning to the query:
P17202 Aminoaldehyde dehydrogenase BADH; 4-trimethylammoniobutyraldehyde dehydrogenase BADH; Aminobutyraldehyde dehydrogenase BADH; Betaine aldehyde dehydrogenase; SoBADH; EC 1.2.1.-; EC 1.2.1.47; EC 1.2.1.19; EC 1.2.1.8 from Spinacia oleracea (Spinach) (see 3 papers)
25% identity, 88% coverage: 5:448/505 of query aligns to 6:445/497 of P17202
- I28 (≠ H28) binding
- D96 (≠ E89) binding
- SPW 156:158 (≠ GAS 154:156) binding
- Y160 (≠ F158) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-(trimethylamino)butanal.
- W167 (≠ G167) mutation to A: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
- KPSE 182:185 (≠ KGHS 182:185) binding
- L186 (≠ A186) binding
- SSAT 236:239 (≠ SLAG 240:243) binding
- V251 (≠ P255) binding in other chain
- L258 (= L264) binding
- W285 (= W288) mutation to A: Decreases binding affinity for betaine aldehyde.
- E390 (= E389) binding
- A441 (≠ R444) mutation to I: Decreases binding affinity for betaine aldehyde; increases binding affinity for 4-aminobutanal.
Sites not aligning to the query:
- 450 C→S: Loss of partial inactivation by betaine aldehyde in the absence of NAD(+).
- 456 binding ; W→A: Decreases binding affinity for betaine aldehyde.
- 460 binding
O75891 Cytosolic 10-formyltetrahydrofolate dehydrogenase; 10-FTHFDH; FDH; Aldehyde dehydrogenase family 1 member L1; EC 1.5.1.6 from Homo sapiens (Human) (see 2 papers)
25% identity, 78% coverage: 56:450/505 of query aligns to 477:863/902 of O75891
- A511 (≠ T90) to V: in a colorectal cancer sample; somatic mutation; dbSNP:rs768309358
Sites not aligning to the query:
- 354 modified: O-(pantetheine 4'-phosphoryl)serine; S→A: Loss of phosphopantetheinylation by AASDHPPT. Loss of formyltetrahydrofolate dehydrogenase activity.
7yjjC Human cytosolic 10-formyltetrahydrofolate dehydrogenase and gossypol complex
25% identity, 78% coverage: 56:450/505 of query aligns to 73:459/498 of 7yjjC
Sites not aligning to the query:
Q8NMB0 Vanillin dehydrogenase; Aromatic aldehyde dehydrogenase; EC 1.2.1.67; EC 1.2.1.64; EC 1.2.1.96 from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
26% identity, 89% coverage: 8:455/505 of query aligns to 12:448/484 of Q8NMB0
- N157 (= N157) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 11-fold decreased affinity for NADP(+) and 2.3-fold decreased affinity for vanillin compared to the wild type.
- K180 (= K182) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 11-fold decreased affinity for NADP(+) and 5-fold decreased affinity for vanillin compared to the wild type.
- E199 (≠ K204) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). 78% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 5-fold decreased affinity for NAD(+), 2.5-fold decreased affinity for NADP(+) and 1.5-fold decreased affinity for vanillin compared to the wild type.
- E258 (= E263) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). 24% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 3.5-fold decreased affinity for NAD(+), 5-fold decreased affinity for NADP(+) and 3.7-fold decreased affinity for vanillin compared to the wild type.
- C292 (= C300) mutation to A: Less than 50% of the activity of the wild-type with vanillin as substrate in the presence of NAD(+). Less than 10% of the activity of the wild-type with vanillin as substrate in the presence of NADP(+). 4.5-fold decreased affinity for NAD(+), 7-fold decreased affinity for NADP(+) and 8-fold decreased affinity for vanillin compared to the wild type.
2d4eC Crystal structure of the hpcc from thermus thermophilus hb8
27% identity, 87% coverage: 9:449/505 of query aligns to 29:465/515 of 2d4eC
- active site: N173 (= N157), K196 (= K182), E271 (= E263), C305 (= C300), E409 (= E389)
- binding nicotinamide-adenine-dinucleotide: I169 (≠ F153), T170 (≠ G154), P171 (≠ A155), W172 (≠ S156), K196 (= K182), A198 (≠ H184), G229 (≠ S219), G233 (= G223), A234 (≠ H224), T248 (= T238), G249 (= G239), E250 (≠ S240), T253 (≠ G243), E271 (= E263), L272 (= L264), C305 (= C300), E409 (= E389), F411 (= F391)
Sites not aligning to the query:
Q59931 NADP-dependent glyceraldehyde-3-phosphate dehydrogenase; Glyceraldehyde-3-phosphate dehydrogenase [NADP(+)]; Non-phosphorylating glyceraldehyde 3-phosphate dehydrogenase; Triosephosphate dehydrogenase; EC 1.2.1.9 from Streptococcus mutans serotype c (strain ATCC 700610 / UA159) (see 3 papers)
26% identity, 84% coverage: 3:424/505 of query aligns to 1:412/475 of Q59931
- R103 (= R103) binding
- S151 (≠ G154) binding
- K177 (= K182) binding
- T180 (≠ S185) binding
- D215 (≠ H224) binding
- 230:251 (vs. 239:264, 27% identical) binding
- E377 (= E389) binding
Sites not aligning to the query:
3u4jA Crystal structure of NAD-dependent aldehyde dehydrogenase from sinorhizobium meliloti
28% identity, 78% coverage: 60:453/505 of query aligns to 82:461/505 of 3u4jA
Sites not aligning to the query:
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
28% identity, 57% coverage: 40:328/505 of query aligns to 43:312/489 of 4cazA
- active site: N152 (= N157), K175 (= K182), E251 (= E263), C285 (= C300)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (≠ F153), G149 (= G154), W151 (≠ S156), N152 (= N157), K175 (= K182), E178 (≠ S185), G208 (≠ S219), G212 (= G223), F226 (= F237), T227 (= T238), G228 (= G239), G229 (≠ S240), T232 (≠ G243), V236 (≠ L247), E251 (= E263), L252 (= L264), C285 (= C300)
Sites not aligning to the query:
- active site: 386, 463
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: 386, 388
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
28% identity, 57% coverage: 40:328/505 of query aligns to 43:312/489 of 2woxA
- active site: N152 (= N157), K175 (= K182), E251 (= E263), C285 (= C300)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (≠ F153), G149 (= G154), W151 (≠ S156), N152 (= N157), K175 (= K182), S177 (≠ H184), E178 (≠ S185), G208 (≠ S219), G212 (= G223), F226 (= F237), T227 (= T238), G228 (= G239), G229 (≠ S240), T232 (≠ G243), V236 (≠ L247), E251 (= E263), L252 (= L264), C285 (= C300)
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
28% identity, 57% coverage: 40:328/505 of query aligns to 43:312/489 of 2wmeA
- active site: N152 (= N157), K175 (= K182), E251 (= E263), C285 (= C300)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (= G154), W151 (≠ S156), K175 (= K182), S177 (≠ H184), E178 (≠ S185), G208 (≠ S219), G212 (= G223), F226 (= F237), G228 (= G239), G229 (≠ S240), T232 (≠ G243), V236 (≠ L247)
Sites not aligning to the query:
Query Sequence
>SM_b20262 FitnessBrowser__Smeli:SM_b20262
MIFTPKGKHLVAGEWLDGAGTFASAPAHGPAHDFAVGTVELVNRACEAAEEAFWTYGYSS
RKERAAFLRAIADEIEARAEAITEIGSQETGLPEARLNGERGRTTGQLRLFADHIEKGDY
LDRRVDAAMPERQPAPRQEIRLVQRPVGPVAVFGASNFPLAFSTAGGDTAAALAAGCPVV
VKGHSAHPGTGEIVAEAVDAAIRKTGVHPGVFSLIQGGSRDVGHALVQHPHIKAVGFTGS
LAGGRALFDLCAARPEPIPFFGELGSVNPMFLLPEALKARAETLGQGWAGSLTMGAGQFC
TNPGIAVVIEGADADRFTTAAVEALAKVAPQTMLTDGIAKAYRDGQARFATRNAVKPLLA
TESSGRDASPNLFETTGAQFLADHALGEEVFGPLGLVVRVGSPAEMEELARGFQGQLTAT
IHMDAGDLETARRLRPVLERKAGRVLVNGFPTGVEVVDSMVHGGPYPASTNFGATSVGTM
SIRRFLRPVAYQNMPEDLLPEDFLG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory