SitesBLAST
Comparing SM_b20267 FitnessBrowser__Smeli:SM_b20267 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 12 hits to proteins with known functional sites (download)
S5FMM4 Glycine oxidase; GO; BliGO; EC 1.4.3.19 from Bacillus licheniformis (see paper)
26% identity, 59% coverage: 169:412/413 of query aligns to 120:363/369 of S5FMM4
- S202 (≠ A252) mutation to C: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, V-332 and V-342.
- I332 (≠ L382) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-342.
- M342 (≠ V392) mutation to V: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, R-81, C-202 and V-332.
Sites not aligning to the query:
- 51 G→S: Shows 4.3- and 107-fold increase of affinity to glyphosate and glycine, respectively. Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with R-54, R-81, C-202, V-332 and V-342.
- 54 A→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-81, C-202, V-332 and V-342.
- 81 K→R: Shows 7.1- and 8-fold increase of affinity and catalytic efficiency to glyphosate, respectively, while the substrate affinity to glycine decreases 235-fold and catalytic efficiency decreases 113-fold; when associated with S-51, R-54, C-202, V-332 and V-342.
6j39A Crystal structure of cmis2 with inhibitor (see paper)
27% identity, 97% coverage: 14:413/413 of query aligns to 11:368/368 of 6j39A
- binding (3R)-3-[(carboxymethyl)sulfanyl]nonanoic acid: M44 (≠ I54), P46 (= P56), N49 (≠ S59), R243 (≠ T288), Y252 (≠ F297), Y267 (≠ V312), R308 (= R352), R334 (≠ H379), I335 (≠ L380)
- binding flavin-adenine dinucleotide: I11 (≠ V14), V29 (≠ L32), D30 (= D33), P31 (≠ R34), E32 (= E35), K36 (≠ G40), A37 (= A41), S38 (= S42), V40 (≠ G44), S41 (≠ N45), A42 (= A46), G43 (= G47), M44 (≠ I54), A174 (≠ V223), A203 (= A252), W206 (≠ F255), I228 (≠ N276), Y252 (≠ F297), R308 (= R352), S333 (≠ G378), R334 (≠ H379), I335 (≠ L380), G336 (= G381), V337 (≠ L382), Q338 (≠ T383)
Sites not aligning to the query:
6j38A Crystal structure of cmis2 (see paper)
27% identity, 97% coverage: 14:413/413 of query aligns to 11:368/368 of 6j38A
- binding flavin-adenine dinucleotide: I11 (≠ V14), V29 (≠ L32), D30 (= D33), P31 (≠ R34), K36 (≠ G40), A37 (= A41), S38 (= S42), S41 (≠ N45), A42 (= A46), G43 (= G47), M44 (≠ I54), A174 (≠ V223), A203 (= A252), W206 (≠ F255), G226 (= G274), G306 (= G350), R308 (= R352), S333 (≠ G378), R334 (≠ H379), I335 (≠ L380), G336 (= G381), V337 (≠ L382), Q338 (≠ T383)
Sites not aligning to the query:
O31616 Glycine oxidase; GO; EC 1.4.3.19 from Bacillus subtilis (strain 168) (see 3 papers)
27% identity, 39% coverage: 245:404/413 of query aligns to 195:354/369 of O31616
- H244 (= H295) mutation to A: 2-fold decrease in catalytic efficiency on glycine and similar catalytic efficiency on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and R-54.
- R302 (= R352) binding
- 327:333 (vs. 377:383, 29% identical) binding
- R329 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
- 51 G→R: 130-fold decrease in catalytic efficiency on glycine and 28-fold increase in that on glyphosate.; G→S: 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with R-54 and A-244.
- 54 A→R: 20-fold decrease in catalytic efficiency on glycine and 34-fold increase in that on glyphosate. 60-fold decrease in catalytic efficiency on glycine and 210-fold increase in that on glyphosate; when associated with S-51 and A-244.
- 174 binding
1ng3A Complex of thio (glycine oxidase) with acetyl-glycine (see paper)
27% identity, 39% coverage: 245:404/413 of query aligns to 195:354/364 of 1ng3A
- binding acetylamino-acetic acid: Y246 (≠ F297), R302 (= R352), R329 (≠ H379)
- binding flavin-adenine dinucleotide: S202 (≠ A252), G203 (= G253), W205 (≠ F255), F209 (≠ V259), G300 (= G350), R302 (= R352), H327 (= H377), R329 (≠ H379), N330 (≠ L380), G331 (= G381), I332 (≠ L382)
- binding phosphate ion: R254 (≠ G305)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 33, 34, 35, 41, 42, 43, 46, 47, 48, 49, 174
- binding phosphate ion: 89
5i39A High resolution structure of l-amino acid deaminase from proteus vulgaris with the deletion of the specific insertion sequence (see paper)
22% identity, 99% coverage: 5:413/413 of query aligns to 26:383/383 of 5i39A
- active site: F66 (≠ A46), Q69 (≠ F49), A70 (= A50), Q248 (vs. gap), P267 (= P280)
- binding flavin-adenine dinucleotide: V30 (≠ I9), G31 (= G10), G33 (= G12), I34 (≠ V13), L35 (≠ V14), V53 (≠ L32), E54 (≠ D33), K55 (≠ R34), Q62 (≠ S42), S63 (≠ A43), F66 (≠ A46), Y67 (≠ G47), Q69 (≠ F49), A196 (≠ E222), A197 (≠ V223), G226 (≠ A252), G227 (= G253), W229 (≠ F255), Q248 (vs. gap), Q250 (vs. gap), G321 (= G350), M323 (≠ R352), T348 (≠ H377), G349 (= G378), W350 (≠ L380), G351 (= G381), M352 (≠ L382), T353 (= T383)
4yshA Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 57% coverage: 176:412/413 of query aligns to 131:367/370 of 4yshA
- active site: I262 (≠ V308), L283 (≠ M329), G305 (= G350), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V223), S206 (≠ A252), G207 (= G253), W209 (≠ F255), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ L380), G336 (= G381), I337 (≠ L382)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 47, 48
4yshB Crystal structure of glycine oxidase from geobacillus kaustophilus
26% identity, 57% coverage: 176:412/413 of query aligns to 131:367/368 of 4yshB
- active site: I262 (≠ V308), L283 (≠ M329), G305 (= G350), N335 (≠ L380), L338 (≠ T383)
- binding flavin-adenine dinucleotide: V178 (= V223), S206 (≠ A252), W209 (≠ F255), R307 (= R352), H332 (= H377), R334 (≠ H379), N335 (≠ L380), G336 (= G381), I337 (≠ L382), L338 (≠ T383)
- binding glycine: G249 (≠ H295), Y251 (≠ F297), Y251 (≠ F297), A264 (≠ G310), R307 (= R352), R334 (≠ H379), R334 (≠ H379)
Sites not aligning to the query:
- active site: 45, 48, 49, 52
- binding flavin-adenine dinucleotide: 9, 10, 12, 14, 32, 33, 34, 40, 41, 42, 45, 46, 48
3if9A Crystal structure of glycine oxidase g51s/a54r/h244a mutant in complex with inhibitor glycolate (see paper)
27% identity, 39% coverage: 245:404/413 of query aligns to 195:354/364 of 3if9A
- binding flavin-adenine dinucleotide: S202 (≠ A252), G203 (= G253), W205 (≠ F255), F209 (≠ V259), G300 (= G350), R302 (= R352), H327 (= H377), F328 (≠ G378), R329 (≠ H379), N330 (≠ L380), G331 (= G381), I332 (≠ L382)
- binding glycolic acid: Y246 (≠ F297), R302 (= R352), R329 (≠ H379)
Sites not aligning to the query:
- active site: 47, 48, 49
- binding flavin-adenine dinucleotide: 11, 13, 15, 34, 35, 42, 43, 46, 47, 48, 49, 173, 174
Q5L2C2 Glycine oxidase; GO; GOX; GOXK; EC 1.4.3.19 from Geobacillus kaustophilus (strain HTA426)
26% identity, 57% coverage: 176:412/413 of query aligns to 132:369/377 of Q5L2C2
- V180 (= V223) binding
- R309 (= R352) binding
- 334:340 (vs. 377:383, 29% identical) binding
- R336 (≠ H379) binding
Sites not aligning to the query:
- 14:15 binding
- 34:35 binding
- 42:43 binding
- 47:49 binding
5hxwA L-amino acid deaminase from proteus vulgaris (see paper)
34% identity, 23% coverage: 321:413/413 of query aligns to 341:433/433 of 5hxwA
- binding cetyl-trimethyl-ammonium: M373 (≠ R352), E379 (≠ S358), G399 (= G378), W400 (≠ L380)
- binding flavin-adenine dinucleotide: G371 (= G350), M373 (≠ R352), T398 (≠ H377), G399 (= G378), W400 (≠ L380), G401 (= G381), M402 (≠ L382), T403 (= T383)
Sites not aligning to the query:
- active site: 58, 61, 62, 240, 284, 288
- binding cetyl-trimethyl-ammonium: 291, 294, 310, 311, 317, 318, 320
- binding flavin-adenine dinucleotide: 22, 23, 25, 26, 27, 46, 47, 53, 54, 55, 57, 58, 59, 60, 61, 188, 189, 218, 219, 221, 240, 242, 331
6pxsA Crystal structure of iminodiacetate oxidase (idaa) from chelativorans sp. Bnc1 (see paper)
24% identity, 47% coverage: 216:410/413 of query aligns to 167:365/370 of 6pxsA
- binding flavin-adenine dinucleotide: Y174 (≠ V223), A203 (= A252), W206 (≠ F255), I210 (≠ V259), Y250 (≠ F297), G305 (= G350), R307 (= R352), G333 (= G378), A334 (≠ H379), S335 (≠ L380), G336 (= G381), L337 (= L382), T338 (= T383)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 7, 9, 10, 30, 32, 33, 36, 37, 38, 40, 41, 42, 43, 44
Query Sequence
>SM_b20267 FitnessBrowser__Smeli:SM_b20267
MAAPDVIVIGAGVVGLTAAIAAVASGLSVTVLDREGPAAGASAGNAGAFAFTDILPLASP
GILKKAPKWLLDPLGPLTVPPAYALKIAPWMFRFWRACQPGRVAHSTAAQTALMDLSKAE
LEPFLGATGTASMLRKEGNLQVYEGEAEFKASLAGWKARADHGIEFRHLDAAGIAEIQPG
LAARFTHATFTPGWYSIADPKLYTLALADHFRTIGGVIERAEVTALKPVDGGVEVLSADG
RRRRAAQVVLSAGAFSHRVARTLGESIPLETERGYNTTLPADAFDLRTQITFGGHGFVVT
RLSTGIRVGGAVELGGLDLPPNFRRSEAMLKKAQAFLPGLKPEGGVQWMGFRPSLPDSLP
AIGRARATPRVIFAFGHGHLGLTQSAGTARIVADLLTGRTPAIDIAPFSPQRF
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory