Comparing SM_b20277 FitnessBrowser__Smeli:SM_b20277 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6io1B Crystal structure of a novel thermostable (s)-enantioselective omega- transaminase from thermomicrobium roseum (see paper)
38% identity, 94% coverage: 15:436/447 of query aligns to 33:448/448 of 6io1B
Sites not aligning to the query:
5kr6B Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 98% coverage: 3:442/447 of query aligns to 16:460/460 of 5kr6B
5lh9D Amine transaminase crystal structure from an uncultivated pseudomonas species in the plp-bound (internal aldimine) form
39% identity, 94% coverage: 12:431/447 of query aligns to 26:441/449 of 5lh9D
5lhaA Amine transaminase crystal structure from an uncultivated pseudomonas species in the pmp-bound form
39% identity, 94% coverage: 12:431/447 of query aligns to 24:439/447 of 5lhaA
5kr5A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 97% coverage: 3:436/447 of query aligns to 12:450/455 of 5kr5A
6s54A Transaminase from pseudomonas fluorescens (see paper)
34% identity, 97% coverage: 2:434/447 of query aligns to 14:447/453 of 6s54A
5kr3A Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 97% coverage: 3:436/447 of query aligns to 15:451/458 of 5kr3A
6gwiB The crystal structure of halomonas elongata amino-transferase (see paper)
37% identity, 96% coverage: 15:443/447 of query aligns to 31:450/450 of 6gwiB
Sites not aligning to the query:
6g4fA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with pmp (see paper)
33% identity, 98% coverage: 1:436/447 of query aligns to 8:443/451 of 6g4fA
6g4eA Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp and 6-aminohexanoate (6-aca) (see paper)
33% identity, 98% coverage: 1:436/447 of query aligns to 8:443/451 of 6g4eA
6g4dB Crystal structure of the omega transaminase from pseudomonas jessenii in complex with plp (see paper)
33% identity, 98% coverage: 1:436/447 of query aligns to 8:443/453 of 6g4dB
5kquC Directed evolution of transaminases by ancestral reconstruction. Using old proteins for new chemistries
35% identity, 97% coverage: 3:436/447 of query aligns to 14:452/459 of 5kquC
6fyqA The crystal structure of a new transaminase from the marine bacterium virgibacillus (see paper)
34% identity, 94% coverage: 18:435/447 of query aligns to 32:435/443 of 6fyqA
Sites not aligning to the query:
7q9xAAA Probable aminotransferase
35% identity, 93% coverage: 15:428/447 of query aligns to 31:435/455 of 7q9xAAA
4a6tC Crystal structure of the omega transaminase from chromobacterium violaceum in complex with plp (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 31:435/455 of 4a6tC
Sites not aligning to the query:
6s4gA Crystal structure of the omega transaminase from chromobacterium violaceum in complex with pmp (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 30:434/453 of 6s4gA
Sites not aligning to the query:
4ba5A Crystal structure of omega-transaminase from chromobacterium violaceum (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 3:407/427 of 4ba5A
4a6rA Crystal structure of the omega transaminase from chromobacterium violaceum in the apo form, crystallised from polyacrylic acid (see paper)
35% identity, 93% coverage: 15:428/447 of query aligns to 2:403/423 of 4a6rA
3gjuA Crystal structure of a putative aminotransferase (mll7127) from mesorhizobium loti maff303099 at 1.55 a resolution
33% identity, 97% coverage: 6:440/447 of query aligns to 23:458/458 of 3gjuA
Sites not aligning to the query:
6zhkA Crystal structure of adenosylmethionine-8-amino-7-oxononanoate aminotransferase from methanocaldococcus jannaschii dsm 2661
31% identity, 94% coverage: 18:438/447 of query aligns to 33:436/438 of 6zhkA
Sites not aligning to the query:
>SM_b20277 FitnessBrowser__Smeli:SM_b20277
MTHLLHRAIHAKLPVAVRGEGIRLFDAEGRAYIDASGGAAVSCLGHAHPDVLAALHAQLD
RIAYAHTGFFTTEAAERLADRLVADAPDGLDHVYLVSGGSEAVEAALKMARQYFVEKGEP
QRRHIIARRQSYHGNTLGALAAGGNEWRRAQFRPLLVETHHIDPCFAYRLQQAGESDTDY
AARAAGQLEAKILELGADQVIAFVAETVVGATAGAVPPVADYLKRVRAICDKYGVLLILD
EVMCGMGRTGTLHACEQDGVVPDLMTIAKGLGGGYQPVGAVLLSSAIFQAFSEGSGFFQH
GHTYMGHPMAAAAGLAVQEVIRRDGLLENVVSMGDYLERCLVERLGNHHHVGDIRGRGLF
RAVELVADRATKSPFDPGLKLNARIKKEAMARGLMVYPMGGTIDGQRGDHVLLAPPFILN
REDVGQIVERLGDAVDAAIASLTKAAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory