Comparing SM_b20282 FitnessBrowser__Smeli:SM_b20282 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 2 hits to proteins with known functional sites (download)
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
24% identity, 57% coverage: 60:208/263 of query aligns to 259:427/490 of 4ki0F
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
24% identity, 57% coverage: 60:208/263 of query aligns to 274:442/514 of P02916
>SM_b20282 FitnessBrowser__Smeli:SM_b20282
MRPYFADLPKTALGAAYWLFAVYLLLPLALMTAMSFKDASFVAFPITDWTLNWYAQVLND
KQFIEASLYSIGIALATTAAATVIGVWIALLVSTEGIWGKAIIFALACLPAVVPGLINAI
SMRIFIRTVDIPTGTAAIILSHAVHAVPFVVIMVLTRLRSMPANLVDAARDLGADRFVAF
LRVTIPYLMPALLGGMIFCVLTSIDDFVRTFFLGGYKPTLPMLIFAKVQGGMSPEINAMA
TIVLVVTAAVGVYAEHLTRRSRN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory