Comparing SM_b20295 FitnessBrowser__Smeli:SM_b20295 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4magA Crystal structure of the periplasmic sialic acid binding protein from vibrio cholerea (see paper)
46% identity, 92% coverage: 24:319/323 of query aligns to 1:296/307 of 4magA
Sites not aligning to the query:
7a5qB Crystal structure of vcsiap bound to sialic acid (see paper)
46% identity, 92% coverage: 24:319/323 of query aligns to 1:296/299 of 7a5qB
7a5qA Crystal structure of vcsiap bound to sialic acid (see paper)
46% identity, 92% coverage: 24:319/323 of query aligns to 1:296/299 of 7a5qA
7t3eA Structure of the sialic acid bound tripartite atp-independent periplasmic (trap) periplasmic component siap from photobacterium profundum (see paper)
43% identity, 92% coverage: 27:322/323 of query aligns to 5:300/300 of 7t3eA
P44542 Sialic acid-binding periplasmic protein SiaP; Extracytoplasmic solute receptor protein SiaP; N-acetylneuraminic-binding protein; Neu5Ac-binding protein from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) (see 2 papers)
39% identity, 95% coverage: 1:307/323 of query aligns to 2:309/329 of P44542
2cexA Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 4:285/304 of 2cexA
Sites not aligning to the query:
3b50A Structure of h. Influenzae sialic acid binding protein bound to neu5ac. (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 5:286/310 of 3b50A
2cexB Structure of a sialic acid binding protein (siap) in the presence of the sialic acid acid analogue neu5ac2en (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 4:285/305 of 2cexB
Sites not aligning to the query:
2v4cA Structure of sialic acid binding protein (siap) in the presence of kdn (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 5:286/309 of 2v4cA
2wx9A Crystal structure of the sialic acid binding periplasmic protein siap (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 5:286/308 of 2wx9A
4mnpA Structure of the sialic acid binding protein from fusobacterium nucleatum subsp. Nucleatum atcc 25586 (see paper)
38% identity, 92% coverage: 26:323/323 of query aligns to 3:304/305 of 4mnpA
2xwoA Siap r147e mutant in complex with sialylamide (see paper)
39% identity, 87% coverage: 27:307/323 of query aligns to 5:286/308 of 2xwoA
4mmpA Structure of sialic acid binding protein from pasturella multocida (see paper)
40% identity, 89% coverage: 27:312/323 of query aligns to 6:292/308 of 4mmpA
4pddA Crystal structure of a trap periplasmic solute binding protein from polaromonas sp js666 (bpro_0088, target efi-510167) bound to d- erythronate (see paper)
34% identity, 86% coverage: 42:319/323 of query aligns to 19:297/303 of 4pddA
Sites not aligning to the query:
4p9kA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to d- erythronate with residual density suggestive of superposition with copurified alternative ligand. (see paper)
32% identity, 89% coverage: 26:312/323 of query aligns to 5:292/303 of 4p9kA
4pakA Crystal structure of a trap periplasmic solute binding protein from verminephrobacter eiseniae ef01-2 (veis_3954, target efi-510324) a nephridial symbiont of the earthworm eisenia foetida, bound to (r)- pantoic acid (see paper)
32% identity, 89% coverage: 26:312/323 of query aligns to 6:293/304 of 4pakA
4o8mA Crystal structure of a trap periplasmic solute binding protein actinobacillus succinogenes 130z, target efi-510004, with bound l- galactonate (see paper)
32% identity, 84% coverage: 36:305/323 of query aligns to 13:282/303 of 4o8mA
4x8rA Crystal structure of a trap periplasmic solute binding protein from rhodobacter sphaeroides (rsph17029_2138, target efi-510205) with bound glucuronate
35% identity, 86% coverage: 26:304/323 of query aligns to 5:284/304 of 4x8rA
Q16BC9 Solute-binding protein RD1_1052 from Roseobacter denitrificans (strain ATCC 33942 / OCh 114) (Erythrobacter sp. (strain OCh 114)) (Roseobacter denitrificans) (see paper)
34% identity, 73% coverage: 56:292/323 of query aligns to 60:295/325 of Q16BC9
4pcdA Crystal structure of a trap periplasmic solute binding protein from roseobacter denitrificans och 114 (rd1_1052, target efi-510238) with bound l-galactonate (see paper)
34% identity, 73% coverage: 56:292/323 of query aligns to 36:271/300 of 4pcdA
>SM_b20295 FitnessBrowser__Smeli:SM_b20295
MKTGMISLALAGLLMASQAMAQEARTLRLGMQGTAGDPQFEGVTEAARIIKEKSGGRLTL
EIFPNSQLGTFTEMMEQVTLGELDFTLNPFGGMDAWVPRAVLASTAYVVGDFDHLQKIIA
SDWGKGIVDEMRTEHKWRMVDSWYFGTRHTTAKKPIEKPADFAGMKLRVPNSAPLLTWAK
AMGASPTPVAFAEVYLALQTNQVDGQENPLPIIDSMKFTEVQSHVSLTGHLVQDQVILMS
EDTWNALEPADQKVVMEAFEAGGALNDKLVSDKEANLVSDFRERGITVVEPDKAAFQEAM
KPVYADLDAKFGADTVKTLLDLR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory