Comparing SM_b20299 FitnessBrowser__Smeli:SM_b20299 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3lbcD D-sialic acid aldolase complexed with l-arabinose
43% identity, 94% coverage: 2:281/299 of query aligns to 4:286/296 of 3lbcD
1fdzA N-acetylneuraminate lyase in complex with pyruvate via borohydride reduction (see paper)
42% identity, 94% coverage: 2:281/299 of query aligns to 1:283/292 of 1fdzA
1fdyA N-acetylneuraminate lyase in complex with hydroxypyruvate (see paper)
42% identity, 94% coverage: 2:281/299 of query aligns to 1:283/292 of 1fdyA
2wpbA Crystal structure of the e192n mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate and the inhibitor (2r,3r)-2,3,4- trihydroxy-n,n-dipropylbutanamide in space group p21 crystal form i (see paper)
42% identity, 94% coverage: 2:281/299 of query aligns to 9:291/302 of 2wpbA
8u8wA Crystal structure of n-acetylneuraminate lyase (nana) from klebsiella aerogenes (pyruvate and halides bound)
43% identity, 93% coverage: 3:280/299 of query aligns to 6:289/297 of 8u8wA
4bwlA Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
41% identity, 97% coverage: 2:291/299 of query aligns to 6:298/299 of 4bwlA
4bwlC Structure of the y137a mutant of e. Coli n-acetylneuraminic acid lyase in complex with pyruvate, n-acetyl-d-mannosamine and n- acetylneuraminic acid (see paper)
42% identity, 94% coverage: 2:281/299 of query aligns to 4:286/296 of 4bwlC
Q2G160 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Staphylococcus aureus (strain NCTC 8325 / PS 47) (see paper)
34% identity, 95% coverage: 3:285/299 of query aligns to 5:289/293 of Q2G160
5kzdA N-acetylneuraminate lyase from methicillin-resistant staphylococcus aureus with bound sialic acid alditol (see paper)
33% identity, 95% coverage: 3:285/299 of query aligns to 4:280/284 of 5kzdA
Q9S4K9 N-acetylneuraminate lyase; NAL; Neu5Ac lyase; N-acetylneuraminate pyruvate-lyase; N-acetylneuraminic acid aldolase; Sialate lyase; Sialic acid aldolase; Sialic acid lyase; EC 4.1.3.3 from Clostridium perfringens (strain 13 / Type A) (see paper)
34% identity, 94% coverage: 3:282/299 of query aligns to 1:282/288 of Q9S4K9
4imfA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-acetylneuraminic acid (see paper)
33% identity, 90% coverage: 2:271/299 of query aligns to 2:273/292 of 4imfA
4imgA Crystal structure of pasteurella multocida n-acetyl-d-neuraminic acid lyase k164 mutant complexed with n-glycolylneuraminic acid (see paper)
33% identity, 90% coverage: 2:271/299 of query aligns to 3:274/293 of 4imgA
1f7bA Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
33% identity, 89% coverage: 3:268/299 of query aligns to 4:271/293 of 1f7bA
1f74A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii complexed with 4-deoxy-sialic acid (see paper)
33% identity, 89% coverage: 3:268/299 of query aligns to 4:271/293 of 1f74A
1f73A Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form iii in complex with sialic acid alditol (see paper)
33% identity, 89% coverage: 3:268/299 of query aligns to 4:266/288 of 1f73A
1f7bC Crystal structure analysis of n-acetylneuraminate lyase from haemophilus influenzae: crystal form ii in complex with 4-oxo-sialic acid (see paper)
33% identity, 89% coverage: 3:268/299 of query aligns to 4:263/285 of 1f7bC
4wozB Crystal structures of cdnal from clostridium difficile in complex with mannosamine
32% identity, 90% coverage: 3:271/299 of query aligns to 3:273/290 of 4wozB
4woqC Crystal structures of cdnal from clostridium difficile in complex with ketobutyric
32% identity, 90% coverage: 3:271/299 of query aligns to 3:273/290 of 4woqC
6rd1A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant in complex with sialic acid (see paper)
33% identity, 94% coverage: 2:283/299 of query aligns to 5:292/304 of 6rd1A
6rb7A Ruminococcus gnavus sialic acid aldolase catalytic lysine mutant (see paper)
33% identity, 94% coverage: 2:283/299 of query aligns to 6:293/305 of 6rb7A
>SM_b20299 FitnessBrowser__Smeli:SM_b20299
MKLEGIYSALLTPFSEDESIDRQAIGALVDFQVRLGIDGVYVGGSSGEAMLQSLDERADY
LSDVAAAASGRLTLIAHVGTIATRDALRLSQHAAKSGYQAISAIPPFYYDFSRPEVMAHY
RELADVSALPLIVYNFPARTSGFTLPELVELLSHPNIIGIKHTSSDMFQLERIRHAVPDA
IVYNGYDEMCLAGFAMGAQGAIGTTYNFMGDLFVALRDCAAAGRIEEARRLQAMANRVIQ
VLIKVGVMPGSKALLGIMGLPGGPSRRPFRKVEEADLAALREAVAPVLAWRESTSRKSM
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory