SitesBLAST
Comparing SM_b20307 FitnessBrowser__Smeli:SM_b20307 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
38% identity, 89% coverage: 24:214/215 of query aligns to 23:211/211 of 4lrzA
- binding adenosine-5'-diphosphate: D31 (= D32), D36 (= D37), D38 (= D39), H39 (= H40), G79 (≠ A82), A80 (≠ S83), S81 (≠ T84), L84 (= L87), G122 (= G125), T130 (= T133), M131 (= M134), G178 (= G181), D192 (= D195), P193 (= P196), G194 (= G197)
- binding magnesium ion: D31 (= D32), D36 (= D37), D36 (= D37), D38 (= D39), D38 (= D39)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
38% identity, 89% coverage: 24:214/215 of query aligns to 22:210/210 of P76014
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
35% identity, 94% coverage: 11:212/215 of query aligns to 8:191/192 of 3cr3A
- binding adenosine-5'-diphosphate: D29 (= D32), D34 (= D37), D36 (= D39), H37 (= H40), N40 (≠ T43), G77 (≠ A82), A78 (≠ S83), S79 (≠ T84), L82 (= L87), G115 (= G125), A117 (≠ G127), T123 (= T133), D174 (= D195), P175 (= P196), G176 (= G197)
- binding magnesium ion: D29 (= D32), D34 (= D37), D34 (= D37), D36 (= D39), D36 (= D39)
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
35% identity, 94% coverage: 11:212/215 of query aligns to 8:191/192 of Q9CIV7
- D29 (= D32) binding
- D34 (= D37) binding
- D36 (= D39) binding
- HGAN 37:40 (≠ HGIT 40:43) binding
- AS 78:79 (≠ ST 83:84) binding
- R114 (= R124) mutation to A: Reduces activity 3-fold.; mutation to E: Reduces activity 100-fold.
- G115 (= G125) binding
- M124 (= M134) binding
- R161 (= R182) mutation to A: Loss of activity.
- Y164 (≠ R185) mutation to A: Reduces activity about 20-fold.
- DPG 174:176 (= DPG 195:197) binding
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
32% identity, 91% coverage: 5:200/215 of query aligns to 369:561/575 of Q3LXA3
- D401 (= D37) mutation to A: Abolishes both kinase and FMN cyclase activities.
- D403 (= D39) mutation to A: Abolishes both kinase and FMN cyclase activities.
- C404 (≠ H40) mutation to A: Decreases both kinase and FMN cyclase activities.
- G445 (≠ A82) to S: in TKFCD; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs1590578831
- S446 (= S83) mutation to A: Decreases both kinase and FMN cyclase activities.
- R543 (= R182) to I: in TKFCD; reduced protein levels in patient cells; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs547013163
- D556 (= D195) mutation to A: Abolishes both kinase and FMN cyclase activities.
Sites not aligning to the query:
- 112 T→A: Highly decreases kinase activity. No effect on FMN cyclase activity.
- 185 A → T: in dbSNP:rs2260655
- 204 K→A: Slightly decreases kinase activity. No effect on FMN cyclase activity.
- 221 H→A: Abolishes kinase activity but not FMN cyclase activity.
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
26% identity, 93% coverage: 13:211/215 of query aligns to 361:549/552 of P45510
- D380 (= D32) mutation to A: Loss of kinase activity.
- D385 (= D37) mutation to A: Loss of kinase activity.
- DGDT 385:388 (≠ DADH 37:40) binding
- D387 (= D39) mutation to A: Loss of kinase activity.
- T388 (≠ H40) mutation to H: Reduced kinase activity.
- SS 431:432 (≠ ST 83:84) binding
- G468 (= G125) binding
- TM 476:477 (= TM 133:134) binding
- DPG 533:535 (= DPG 195:197) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 220 active site, Tele-hemiaminal-histidine intermediate
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
25% identity, 93% coverage: 13:211/215 of query aligns to 361:536/537 of 1un9A
- binding phosphoaminophosphonic acid-adenylate ester: D385 (= D37), D387 (= D39), T388 (≠ H40), T391 (= T43), G430 (≠ A82), S431 (= S83), S432 (≠ T84), L435 (= L87), G468 (= G125), A470 (≠ G127), T476 (= T133), M477 (= M134), D520 (= D195), G522 (= G197)
- binding magnesium ion: D380 (= D32), D385 (= D37), D385 (= D37), D387 (= D39), D387 (= D39)
Sites not aligning to the query:
Query Sequence
>SM_b20307 FitnessBrowser__Smeli:SM_b20307
MMSESAVRRLIEVFEAISSAIEAERDHLSELDGAIGDADHGITMAIGFSAVTGELARTDA
GSAGLSGVMTAAASAFLNAVGASTGPLYATAFRRAAQALEGRDTLDIEACSLLIQAVASG
IGERGKGQRGDKTMLDVWLPAADAAAQAVAAAKSTAAFWADVTAAAENGASATRSMVATK
GRAARVGERSLGHMDPGAASAVLIIRAMAQTLREG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory