Comparing SM_b20312 FitnessBrowser__Smeli:SM_b20312 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
P76015 PEP-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
40% identity, 48% coverage: 363:693/695 of query aligns to 1:353/356 of P76015
Q9CIV8 PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
40% identity, 46% coverage: 364:682/695 of query aligns to 4:322/332 of Q9CIV8
3ct4A Structure of dha-kinase subunit dhak from l. Lactis (see paper)
40% identity, 46% coverage: 364:682/695 of query aligns to 1:309/318 of 3ct4A
1uodA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with dihydroxyacetone-phosphate (see paper)
40% identity, 46% coverage: 372:693/695 of query aligns to 1:333/336 of 1uodA
1uoeA Crystal structure of the dihydroxyacetone kinase from e. Coli in complex with glyceraldehyde (see paper)
40% identity, 46% coverage: 372:693/695 of query aligns to 1:333/336 of 1uoeA
3pnqD Crystal structure of e.Coli dha kinase dhak (h56n) complex with dha (see paper)
39% identity, 46% coverage: 372:693/695 of query aligns to 1:331/334 of 3pnqD
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
34% identity, 46% coverage: 364:683/695 of query aligns to 4:327/575 of Q3LXA3
Sites not aligning to the query:
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
31% identity, 47% coverage: 366:690/695 of query aligns to 5:325/537 of 1un9A
Sites not aligning to the query:
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
31% identity, 47% coverage: 366:690/695 of query aligns to 5:325/552 of P45510
Sites not aligning to the query:
4l5jA Crystal structures of the lsrr proteins complexed with phospho-ai-2 and its two different analogs reveal distinct mechanisms for ligand recognition (see paper)
30% identity, 43% coverage: 39:336/695 of query aligns to 15:308/308 of 4l5jA
4oqpA Structure of the effector-binding domain of deoxyribonucleoside regulator deor from bacillus subtilis in complex with deoxyribose-5- phosphate (see paper)
28% identity, 35% coverage: 93:334/695 of query aligns to 11:253/254 of 4oqpA
4l4zA Crystal structures of the lsrr proteins complexed with phospho-ai-2 and its two different analogs reveal distinct mechanisms for ligand recognition (see paper)
30% identity, 35% coverage: 92:336/695 of query aligns to 9:249/249 of 4l4zA
4l50A Crystal structures of the lsrr proteins complexed with phospho-ai-2 and its two different analogs reveal distinct mechanisms for ligand recognition (see paper)
30% identity, 35% coverage: 92:336/695 of query aligns to 10:248/248 of 4l50A
3bxhA Crystal structure of effector binding domain of central glycolytic gene regulator (cggr) from bacillus subtilis in complex with fructose-6-phosphate (see paper)
24% identity, 36% coverage: 89:335/695 of query aligns to 5:246/248 of 3bxhA
3bxgA Crystal structure of effector binding domain of central glycolytic gene regulator (cggr) from bacillus subtilis in complex with glucose- 6-phosphate (see paper)
24% identity, 36% coverage: 89:335/695 of query aligns to 5:246/247 of 3bxgA
3bxfA Crystal structure of effector binding domain of central glycolytic gene regulator (cggr) from bacillus subtilis in complex with effector fructose-1,6-bisphosphate (see paper)
24% identity, 36% coverage: 89:335/695 of query aligns to 12:253/253 of 3bxfA
2okgB Structure of effector binding domain of central glycolytic gene regulator (cggr) from b. Subtilis (see paper)
24% identity, 36% coverage: 89:335/695 of query aligns to 10:251/251 of 2okgB
>SM_b20312 FitnessBrowser__Smeli:SM_b20312
MTIKTPSARKGAANRSGTIDASDAIPLRYGDDPYVWACWLYYEDGMTQGEIAEAMGVSRA
TVNSYLADAREKGIVNISIEPARLASLTIAQELKRHFGLTDCLVVPSDDNARPLIDRLGA
AGAQALPKLLKSGDTLAVAWGRTVLSVGEHAGIASLQDMTVVQATGGTTASFAYTPELCA
SAVARAISARCVNITAPAVVKSPELLHMLLEEPLVQEQFATLARANRVLFGISSLRPNST
IHTSGFFESVSLQDYLAAGAVGVVAGRFIDERGRPVAGPLDHRTVGISLDLLRKIGTRIA
VAGGFDKVPALLAALRGGYVNVLITDAATGHGILRADGVTALDAKLWHRPKLVPTPSSYR
THVKKFLNNPNEVVEEMLDGAVKAHEIYLQPINGSHRALVARNGPRPGKVGLVIGGGTGH
EPCFLGYVGKGLADAVAVGNIFSSPPPDPIVQCAEAASGGEGVLFVYGNYAGDVMNFEMA
AEIAEEKGIKVKTVLTTDDVASSPVEDREGRRGVAGNFFIFKIAGAACDRGLSLEACEAV
TRKANLRTYTVGVALEPGSMPQTRRHNFEIGPDDMEVGMGIHGEPGVTRERIRSADEITD
SIMDRIFKEMKTAPGERVAVLVNSFGATPLMELYILFRRVQQRLAAKDILIEANWIGHYC
TSLDMAGASITILHLDQELSDLLHHPCETAFLKVN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory