SitesBLAST
Comparing SM_b20313 FitnessBrowser__Smeli:SM_b20313 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
Q9CIV7 PTS-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) (see paper)
39% identity, 82% coverage: 32:218/227 of query aligns to 16:187/192 of Q9CIV7
- D29 (= D45) binding
- D34 (= D50) binding
- D36 (= D52) binding
- HGAN 37:40 (≠ HGVN 53:56) binding
- AS 78:79 (≠ SM 93:94) binding
- R114 (≠ I134) mutation to A: Reduces activity 3-fold.; mutation to E: Reduces activity 100-fold.
- G115 (= G135) binding
- M124 (≠ L144) binding
- R161 (= R192) mutation to A: Loss of activity.
- Y164 (≠ R195) mutation to A: Reduces activity about 20-fold.
- DPG 174:176 (≠ DAG 205:207) binding
3cr3A Structure of a transient complex between dha-kinase subunits dham and dhal from lactococcus lactis (see paper)
39% identity, 82% coverage: 32:218/227 of query aligns to 16:187/192 of 3cr3A
- binding adenosine-5'-diphosphate: D29 (= D45), D34 (= D50), D36 (= D52), H37 (= H53), N40 (= N56), G77 (= G92), A78 (≠ S93), S79 (≠ M94), L82 (= L97), G115 (= G135), A117 (= A137), T123 (= T143), D174 (= D205), P175 (≠ A206), G176 (= G207)
- binding magnesium ion: D29 (= D45), D34 (= D50), D34 (= D50), D36 (= D52), D36 (= D52)
P76014 PEP-dependent dihydroxyacetone kinase, ADP-binding subunit DhaL; EC 2.7.1.121 from Escherichia coli (strain K12) (see 3 papers)
36% identity, 89% coverage: 22:223/227 of query aligns to 14:209/210 of P76014
4lrzA Crystal structure of the e.Coli dhar(n)-dhal complex (see paper)
36% identity, 89% coverage: 22:223/227 of query aligns to 15:210/211 of 4lrzA
- binding adenosine-5'-diphosphate: D31 (= D45), D36 (= D50), D38 (= D52), H39 (= H53), G79 (= G92), A80 (≠ S93), S81 (≠ M94), L84 (= L97), G122 (= G135), T130 (= T143), M131 (≠ L144), G178 (= G191), D192 (= D205), P193 (≠ A206), G194 (= G207)
- binding magnesium ion: D31 (= D45), D36 (= D50), D36 (= D50), D38 (= D52), D38 (= D52)
Q3LXA3 Triokinase/FMN cyclase; Bifunctional ATP-dependent dihydroxyacetone kinase/FAD-AMP lyase (cyclizing); EC 2.7.1.28; EC 2.7.1.29; EC 4.6.1.15 from Homo sapiens (Human) (see 4 papers)
33% identity, 74% coverage: 40:207/227 of query aligns to 391:558/575 of Q3LXA3
- D401 (= D50) mutation to A: Abolishes both kinase and FMN cyclase activities.
- D403 (= D52) mutation to A: Abolishes both kinase and FMN cyclase activities.
- C404 (≠ H53) mutation to A: Decreases both kinase and FMN cyclase activities.
- G445 (= G92) to S: in TKFCD; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs1590578831
- S446 (= S93) mutation to A: Decreases both kinase and FMN cyclase activities.
- R543 (= R192) to I: in TKFCD; reduced protein levels in patient cells; very severe decrease of triokinase and glycerone kinase activities; dbSNP:rs547013163
- D556 (= D205) mutation to A: Abolishes both kinase and FMN cyclase activities.
Sites not aligning to the query:
- 112 T→A: Highly decreases kinase activity. No effect on FMN cyclase activity.
- 185 A → T: in dbSNP:rs2260655
- 204 K→A: Slightly decreases kinase activity. No effect on FMN cyclase activity.
- 221 H→A: Abolishes kinase activity but not FMN cyclase activity.
P45510 Dihydroxyacetone kinase; DHA kinase; Glycerone kinase; EC 2.7.1.29 from Citrobacter freundii (see 2 papers)
31% identity, 93% coverage: 10:219/227 of query aligns to 345:547/552 of P45510
- D380 (= D45) mutation to A: Loss of kinase activity.
- D385 (= D50) mutation to A: Loss of kinase activity.
- DGDT 385:388 (≠ DGDH 50:53) binding
- D387 (= D52) mutation to A: Loss of kinase activity.
- T388 (≠ H53) mutation to H: Reduced kinase activity.
- SS 431:432 (≠ SM 93:94) binding
- G468 (= G135) binding
- TM 476:477 (≠ TL 143:144) binding
- DPG 533:535 (≠ DAG 205:207) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 220 active site, Tele-hemiaminal-histidine intermediate
1un9A Crystal structure of the dihydroxyacetone kinase from c. Freundii in complex with amp-pnp and mg2+ (see paper)
29% identity, 93% coverage: 10:219/227 of query aligns to 345:534/537 of 1un9A
- binding phosphoaminophosphonic acid-adenylate ester: D385 (= D50), D387 (= D52), T388 (≠ H53), T391 (≠ N56), G430 (= G92), S431 (= S93), S432 (≠ M94), L435 (= L97), G468 (= G135), A470 (= A137), T476 (= T143), M477 (≠ L144), D520 (= D205), G522 (= G207)
- binding magnesium ion: D380 (= D45), D385 (= D50), D385 (= D50), D387 (= D52), D387 (= D52)
Sites not aligning to the query:
Query Sequence
>SM_b20313 FitnessBrowser__Smeli:SM_b20313
MSRSAAPPFSEEMDMQTFENARAGDIVLTLADRIIENRAYLSEIDGKIGDGDHGVNMAKG
FGLAAERLKGKDASLAEALDTLGTVLMTEIGGSMGPLYGVMFTEFAEKIEGADAIDAAAY
SRMLHAGLEGIRSIGSAKVGDKTLLDTLVPAVDAFDAATADGRPFAEALDALVSAAEAGR
DSTRDLIARIGRASRLGERSLGVLDAGATSCAIILRELSHGARARLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory