Comparing SM_b20317 FitnessBrowser__Smeli:SM_b20317 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
35% identity, 94% coverage: 13:496/516 of query aligns to 4:480/501 of P04983
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
31% identity, 43% coverage: 16:238/516 of query aligns to 4:217/240 of 4ymuJ
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
29% identity, 46% coverage: 12:248/516 of query aligns to 1:230/241 of 4u00A
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
28% identity, 44% coverage: 8:233/516 of query aligns to 12:224/378 of P69874
Sites not aligning to the query:
6z4wA Ftse structure from streptococcus pneumoniae in complex with adp (space group p 1) (see paper)
29% identity, 47% coverage: 11:251/516 of query aligns to 1:228/230 of 6z4wA
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 44% coverage: 14:238/516 of query aligns to 4:219/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 44% coverage: 14:238/516 of query aligns to 4:219/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 44% coverage: 14:238/516 of query aligns to 4:219/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 44% coverage: 14:238/516 of query aligns to 4:219/242 of 2oljA
6z67B Ftse structure of streptococcus pneumoniae in complex with amppnp at 2.4 a resolution (see paper)
28% identity, 46% coverage: 13:251/516 of query aligns to 3:228/229 of 6z67B
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 44% coverage: 10:238/516 of query aligns to 1:231/254 of 1g6hA
5lj7A Structure of aggregatibacter actinomycetemcomitans macb bound to atp (p21) (see paper)
31% identity, 43% coverage: 11:233/516 of query aligns to 1:218/592 of 5lj7A
5lilA Structure of aggregatibacter actinomycetemcomitans macb bound to atpys (p21) (see paper)
31% identity, 43% coverage: 11:233/516 of query aligns to 1:218/615 of 5lilA
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
27% identity, 44% coverage: 10:238/516 of query aligns to 1:231/253 of 1g9xB
Q9AT00 Protein TRIGALACTOSYLDIACYLGLYCEROL 3, chloroplastic; ABC transporter I family member 13; ABC transporter ABCI.13; AtABCI13; Non-intrinsic ABC protein 11; AtNAP11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
33% identity, 41% coverage: 5:216/516 of query aligns to 76:295/345 of Q9AT00
3d31A Modbc from methanosarcina acetivorans (see paper)
27% identity, 43% coverage: 13:233/516 of query aligns to 1:204/348 of 3d31A
Sites not aligning to the query:
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
31% identity, 44% coverage: 13:241/516 of query aligns to 5:229/233 of P75957
7mdyC Lolcde nucleotide-bound
31% identity, 44% coverage: 13:241/516 of query aligns to 2:226/226 of 7mdyC
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
31% identity, 44% coverage: 13:241/516 of query aligns to 4:228/229 of 7v8iD
7arlD Lolcde in complex with lipoprotein and adp (see paper)
32% identity, 43% coverage: 13:233/516 of query aligns to 2:218/222 of 7arlD
>SM_b20317 FitnessBrowser__Smeli:SM_b20317
MPSAGARSDTMPFLEVRDLEKRFGGVRALKGVSFTIERGRTYHLMGENGCGKSTLIKIIS
GAQPADGGELTINGKKVEGLTPIGALAAGIETVYQDLSLLPNLSVEENVALTQQLVASNG
SLARRLDLKGLRETAVRALKDVGLPTEPAFLSTPVEELPIATRQLIAIARAIASDAGLVI
MDEPTTALTRREVDNLIRVVHGLHAKGVSVLFVTHKLDECKAIGGQAIIMRDGLKVAECD
VATQSKTELGFWMTGKNLDDTRYRVDTHGDETLLSVERLGGAGFDDVSFTVSKGEIFGIT
GLLDSGRNELALSLAGVESARRGSVLLAGRRADLSSPASAIEAGIGYVPEDRLSEGLFLG
KSIRENIVMAVLDRLRGAFGLLDSRRAKALAQKTVDDLQVATPDIDNPVMSLSGGNQQRV
LIGRWLTIEPSLLILHGPTVGVDVGSKDTIFRIIQRLAGDGMSVVIISDDLPELLQNCDR
VMVMRKGRVADIFPAEGLEEDAIYKSMMAEDGQGVQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory